KEGG   Geobacillus sp. JS12: A0V43_04235Help
Entry
A0V43_04235       CDS       T04412                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
gej  Geobacillus sp. JS12
Pathway
gej00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:gej00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A0V43_04235
Enzymes [BR:gej01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     A0V43_04235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF1487
Motif
Other DBs
NCBI-ProteinID: AMQ20306
UniProt: A0A142CZV4
LinkDB All DBs
Position
845909..847375
Genome map
AA seq 488 aa AA seqDB search
MKMGTEKQTYLNYINDEWIHSSTGKIEASLNPANIDDIVGYVQESGAEDVNAAVEAARRA
QAAWRKLSGPKRGEYLFRTADLLEKRLDEIAETMTREMGKTLPEAKGEVQRGVNILRYYA
GEGMRSIGEVIPSTDSEALMFTTRVPLGVVGVITPWNFPVAIPIWKIAPAIVYGNTVVFK
PAQETAVTAAKIVECFDEAGLPAGVVNLVTGKGSIIGNAIAEHPHIHGITFTGSNEVGKT
IAQKAVARGAKYQLEMGGKNPVIVLEDADLDRAVEATISGGLRSTGQKCTATSRVFVQRT
IYDQFKEKLLAKVKQLNIGNGLEDGVWMGPCASQKQLETVLSYIQKGIEEGATLVYGGQR
LTDGERAKGFYVQPTIFENVSPDMTIAREEIFGPVLALIKVDSLEEALSLANDTPFGLSA
SIFTQNIGKMLAFIQDIEAGLVRINEESAGVELQAPFGGMKQSSSHSREQGRAAIEFFTA
MKTVLVKG
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgggaacagaaaaacaaacatacttgaactacatcaatgacgagtggattcat
tcctccactggaaaaatcgaagccagccttaacccagccaacatcgatgacatcgtcggc
tatgtccaagagtccggtgcggaagatgtgaacgccgcggtggaggcggcgcggcgggcg
caggcggcatggcggaagctgtccggcccgaaacgcggagagtatttgttccgcacggcg
gatctcttggagaaacggcttgacgagatcgccgaaacgatgacaagagaaatgggaaaa
acgctcccggaagcaaaaggggaagtgcagcggggagtcaatattttgcgctactacgct
ggggaggggatgcgatccatcggcgaggtcattccatccacggacagcgaagcgttgatg
tttacgacgcgcgtgcctcttggcgtggttggggtcatcacgccgtggaactttccagtc
gccattccgatttggaaaatcgcacctgccatcgtctatggaaacacggtggtgtttaag
ccggcgcaggaaacggcggtcacggcagcgaaaatcgtggaatgctttgacgaggcgggg
ctgccggccggtgtggtgaatttggtgacaggcaaaggatcgatcatcggcaatgcgatc
gccgaacatccccacattcacggcatcaccttcaccggctccaatgaagtcggcaaaacg
atcgcccaaaaagcggtggcccgaggggcgaaataccagctggaaatgggcggaaagaat
ccggtgatcgtgctcgaggacgctgatcttgatcgcgccgtcgaggcaacaatcagcggc
gggctgcgttccacgggacaaaaatgcacggcgacaagccgtgtgttcgtccagcgtacc
atctatgatcaatttaaggaaaaattgttggcaaaagtgaagcagctgaacatcggcaat
ggactcgaggacggcgtttggatggggccgtgcgccagccaaaagcagctcgagacggtc
ctttcttatatccaaaaaggaatcgaagagggggcgacgctcgtttacggaggccaacgt
ttgacggatggggaacgggcaaaagggttttatgtgcagccgaccatctttgaaaacgtg
tcgcccgacatgacgatcgctcgcgaggaaattttcgggccggtgttggcgttaatcaaa
gtggattcgctggaagaagcgctttctctcgccaatgacacaccgtttggattgagcgcc
tcgattttcacgcaaaatatcggcaagatgctcgcgttcatccaagacatcgaagccggg
ctcgtccggatcaatgaagaaagcgcaggagtcgaactgcaagcgccgtttggcgggatg
aagcagtcgagctcccactcgcgggaacaagggcgcgcggccatcgagtttttcacggcg
atgaaaacggtgttggtcaaaggataa

DBGET integrated database retrieval system