KEGG   Geobacillus sp. JS12: A0V43_11610Help
Entry
A0V43_11610       CDS       T04412                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
gej  Geobacillus sp. JS12
Pathway
gej00020  Citrate cycle (TCA cycle)
gej00480  Glutathione metabolism
gej01100  Metabolic pathways
gej01110  Biosynthesis of secondary metabolites
gej01120  Microbial metabolism in diverse environments
gej01130  Biosynthesis of antibiotics
gej01200  Carbon metabolism
gej01210  2-Oxocarboxylic acid metabolism
gej01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gej00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A0V43_11610
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A0V43_11610
Enzymes [BR:gej01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     A0V43_11610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AMQ21433
UniProt: A0A142D331
LinkDB All DBs
Position
complement(2371012..2372283)
Genome map
AA seq 423 aa AA seqDB search
MTQGEKITVQNGVLNVPNNPIIPFIEGDGTGPDIWAAASRVLEAAVEKAYKGEKKIVWKE
VLAGEKAYKLTGSWLPDETLETIREYIIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFPGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGTPEVKKVIDFLQNEMGVRKIR
FPETSGIGIKPISEQGTKRLVRAAINYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EEEFADKVFTWAQYDRIVETEGKEAANKALADAEASGKIIIKDVIADIFLQQILTRPREF
DVIATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVMMFEHLGWNEAAKLIIKAMEKTIAAKIVTYDFARLMEGATEVKCSEFADALIR
NMD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcaaggagaaaaaattacagtccaaaatggtgtgctcaacgttccgaacaacccg
atcattccgttcatcgagggggatggaaccggcccggacatttgggcggccgcttcgcgc
gtgctcgaagcagcggtggaaaaagcgtacaaaggtgagaaaaaaatcgtttggaaggaa
gtgctcgctggtgaaaaagcgtacaagctgacgggcagctggcttccggatgaaacgctt
gagacgatccgcgaatacataatcgccattaaagggccgttgacgacgccggtcggcggc
ggcatccgctcgctgaacgtcgcgctccgccaagagctcgacctgtttgtctgcttgcgc
ccggttcgctacttcccaggcgttccgtcgccggtgaaacgcccggaagacaccgatatg
gtcattttccgggaaaacacggaagacatctacgctggcattgaatatgccaaaggcacg
ccggaagtgaaaaaagtcatcgactttttgcaaaacgaaatgggcgtgcgcaaaatccgc
ttcccggaaacgtccggcatcggcattaaaccgatttccgaacaagggacgaaacggctt
gtgcgcgcggcgatcaactacgcgatcgaacacggccgcaagtcggtgacgctcgttcat
aaaggaaacattatgaaattcaccgaaggcgcgtttaaaaactggggttatgaactggcg
gaggaagaattcgccgacaaagtgttcacgtgggcgcaatacgaccgaatcgttgaaacg
gaaggcaaggaagcggcgaacaaagcgcttgctgatgcggaagcgtccggcaaaatcatt
atcaaagatgtcatcgccgacatcttcctgcaacaaattttgacgcgtccgcgcgaattt
gacgtcatcgcgacgatgaacttaaacggcgactacatttccgacgcgctggccgctcaa
gtcggcggcatcggcatcgcgccgggggcaaacatcaactacgaaaccggccacgcgatt
ttcgaagcgacgcacggcacggcgccgaaatacgcagggcttgacaaagtcaacccatcg
tccgtcattctctcgggcgtcatgatgtttgagcatcttggttggaacgaagcagcgaaa
ttgatcatcaaagcgatggagaaaacgatcgctgcgaaaatcgtcacgtatgacttcgcc
cgcctgatggaaggggcgacggaagtgaaatgctccgaatttgctgatgcgctcatccgc
aatatggactaa

DBGET integrated database retrieval system