KEGG   Geobacillus sp. JS12: A0V43_11635Help
Entry
A0V43_11635       CDS       T04412                                 

Definition
(GenBank) ATP-dependent 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gej  Geobacillus sp. JS12
Pathway
gej00010  Glycolysis / Gluconeogenesis
gej00030  Pentose phosphate pathway
gej00051  Fructose and mannose metabolism
gej00052  Galactose metabolism
gej00680  Methane metabolism
gej01100  Metabolic pathways
gej01110  Biosynthesis of secondary metabolites
gej01120  Microbial metabolism in diverse environments
gej01130  Biosynthesis of antibiotics
gej01200  Carbon metabolism
gej01230  Biosynthesis of amino acids
gej03018  RNA degradation
Module
gej_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gej_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:gej00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A0V43_11635
   00030 Pentose phosphate pathway
    A0V43_11635
   00051 Fructose and mannose metabolism
    A0V43_11635
   00052 Galactose metabolism
    A0V43_11635
  09102 Energy metabolism
   00680 Methane metabolism
    A0V43_11635
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    A0V43_11635
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:gej01009]
    A0V43_11635
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:gej03019]
    A0V43_11635
Enzymes [BR:gej01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     A0V43_11635
Protein phosphatases and associated proteins [BR:gej01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     A0V43_11635
Messenger RNA biogenesis [BR:gej03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     A0V43_11635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Peripla_BP_1 NAD_kinase PucR
Motif
Other DBs
NCBI-ProteinID: AMQ22608
UniProt: A0A142D6F6
LinkDB All DBs
Position
complement(2377516..2378475)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGVEVYGIYHGYAGLIAGNIKKLEVGDVGDI
IHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVVEVMGRHAGDIALWS
GLAGGAETILIPEADYDMDDIIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQIQEATGF
ETRVTVLGHVQRGGSPTAFDRVLASRLGAHAVELLLEGKGGRCVGIQNNQIVDHDIAEAL
AKTHTVDQRMYTLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggattggtgtgttgacaagcggcggcgactcgccgggcatgaatgcggccatt
cgcgctgtcgtccgcaaagcgatttaccatggggtggaagtgtacggaatctaccacggg
tatgccgggttgatcgccggcaatatcaaaaagctggaagtcggggacgtcggggacatc
atccatcgcggcggcaccatcctttataccgcgcgctgcccggagtttaagacggaagaa
ggacagaaaaaggggatcgagcagctgaaaaagcacggcattgaagggctggtcgtcatc
ggcggcgacgggtcgtatcaaggggcgaaaaaattgacggagcacggcttcccgtgcgtc
ggcgtgcccgggacgatcgacaacgacattccaggcaccgatttcacgatcggttttgac
accgcgctcaatacggtcattgacgccattgacaaaatccgcgacacggcgacgtcgcat
gagcggacgtacgtcgtcgaagtgatgggccgccatgccggcgatattgcgctatggtcg
gggcttgccggaggggcggagacgattttgattccggaagcggactacgacatggacgac
atcatcgctcgcttgaagcgcggccatgaacgcggcaaaaaacacagcatcatcatcgtc
gccgagggagtcggcagcggcgtcgacttcggacggcaaattcaagaggcgaccggcttt
gagacgcgcgtgacggtgcttggccacgtgcagcgcggcggatcgccgacggcgtttgac
cgcgtgttagcgagccgcctcggcgcccatgcggtcgagctgctccttgaaggcaaaggc
ggccgctgcgttggcattcaaaacaaccaaatcgtggaccatgacattgccgaagcgttg
gcgaaaacacatacggtcgatcagcggatgtataccttgtcgaaagagctgtcgatttaa

DBGET integrated database retrieval system