KEGG   Geobacillus sp. JS12: A0V43_13210Help
Entry
A0V43_13210       CDS       T04412                                 

Definition
(GenBank) imidazole glycerol phosphate synthase cyclase subunit
  KO
K02500  imidazole glycerol-phosphate synthase subunit HisF [EC:4.3.2.10]
Organism
gej  Geobacillus sp. JS12
Pathway
gej00340  Histidine metabolism
gej01100  Metabolic pathways
gej01110  Biosynthesis of secondary metabolites
gej01230  Biosynthesis of amino acids
Module
gej_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:gej00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    A0V43_13210
Enzymes [BR:gej01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.10  imidazole glycerol-phosphate synthase
     A0V43_13210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_biosynth NMO Dus G3P_antiterm ThiG TMP-TENI IMPDH DHO_dh SBP_bac_3
Motif
Other DBs
NCBI-ProteinID: AMQ21678
UniProt: A0A142D3S6
LinkDB All DBs
Position
complement(2679907..2680665)
Genome map
AA seq 252 aa AA seqDB search
MITKRIIPCLDVKDGRVVKGVQFVQLRDAGDPVELAKAYDEQGADELVFLDISASHEGRK
TMVDVVERVAAELAIPFTVGGGIHSLEDMKWMLRAGADKVSLNTAAVLHPTLITEGADFF
GSQCIVVAIDAKYDETLGSWRVYTHGGRNATEWEVVAWAQEAVRLGAGEILLTSMDADGG
KNGFDIELTRKVSEAVSVPVIASGGAGKAEHFLEAFEKGKADAALAASIFHYKETSVGQV
KAYLKERGVNVR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgatcacgaagcgcatcatcccgtgcctcgatgtgaaagacgggcgcgtcgtcaaagga
gtgcaatttgtccagctgcgcgatgccggcgatccggtggagctcgcgaaggcgtacgat
gagcaaggggcggacgagctcgtgtttttggacatttccgcttcccatgaagggcggaaa
acgatggtcgatgtcgtcgagcgcgtcgccgccgagctcgccattccgtttacggtcggc
ggcggcatccactcgcttgaggatatgaagtggatgcttcgcgccggggcggacaaagtg
tcgctcaacaccgccgcggtgctccatccgaccttgatcacggaaggggcggactttttc
ggttcgcaatgcatcgtcgtcgccattgacgcgaaatacgatgaaacgcttggttcatgg
cgcgtctatacgcacggcggccgcaacgcgaccgaatgggaagtcgtcgcgtgggcgcag
gaagcggtccgtcttggcgccggggagattttgctgacgagcatggacgcggacggcggc
aaaaacggttttgatattgagttgacgcgcaaagtgagcgaagcggtctcggttccggtc
atcgcctcgggcggcgctggcaaggcggagcatttcctcgaagcgttcgaaaaagggaaa
gcagacgcggcgctcgcggcatcgattttccattacaaagaaacgtcggtcgggcaagtg
aaagcgtacttgaaagaaagaggggtgaacgtgcgatga

DBGET integrated database retrieval system