KEGG   Geobacillus sp. JS12: A0V43_13465Help
Entry
A0V43_13465       CDS       T04412                                 

Definition
(GenBank) flagellar cap protein FliD
  KO
K02407  flagellar hook-associated protein 2
Organism
gej  Geobacillus sp. JS12
Pathway
gej02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:gej00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    A0V43_13465
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:gej02035]
    A0V43_13465
Bacterial motility proteins [BR:gej02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    A0V43_13465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliD_C FliD_N Flagellin_IN DUF3869 Imm41
Motif
Other DBs
NCBI-ProteinID: AMQ21715
UniProt: A0A142D3W3
LinkDB All DBs
Position
complement(2733215..2734720)
Genome map
AA seq 501 aa AA seqDB search
MANTLRISGLASGMDIDKIVSDLMKAERAPLDKLKQKKQLLEWQRDDYRAMNTLLQGLDD
YLFSNITLQSSMLKKTVSSSNESVVTATAGSSAANVAAAIQVNQVATSAVWLSDATKRVD
KASFSVDADVTLTINVTNGDGTTKQAAITVKKGTTLDGVIAQLNSNLDLGVSAFYDEQTE
RVSIMKKETGARASLVLADQATADFFAQKLGFAGAIAGQELTGKTAGKDADITINGLQTT
RSSNTFTINGVTYTLKGTGAATVSVATDADAMFNAIKGFVDKYNETIDKINAELKEERYR
DYPPLTDEQKEAMTEKQIELWEEKARSGMLRGDSILSSALSQMRMNVYTKVEGANIPSGF
SQLAQIGITTSSNYLDGGKLIIDETKLREKIKENPDAVYQLFNQDGATDAEKGIARRLRD
TIKATIGKIEQKAGKTIWTNQQFAIGRDLIQINDQIDRFQDRLKQIEDRYYRQFTAMEEA
IQRANQQSMYLMNAFGGGMQG
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatacattgcgcatcagcggcctcgcgagcggaatggacattgacaaaatcgtg
agcgatttgatgaaagcggagcgggcgccgcttgataaattgaagcagaaaaagcagctg
cttgagtggcagcgcgatgattaccgagcgatgaacacgttgcttcaggggcttgacgac
tatttgttcagcaacatcacgctccaaagcagcatgctcaaaaaaaccgtctcgagttcg
aacgaatcggtcgtcacagcgacggcgggctcgagtgcggcgaacgtggcggcggcgatt
caagtcaatcaagtggccacatcggccgtctggctgtccgatgctacgaaaagggtggat
aaagcgagtttctcggtagacgccgatgtcacgctgacgatcaacgtgacaaacggggat
gggacgacgaagcaggcggcgatcacagtgaagaaaggaacgacgctcgatggggtgatc
gcccaactcaacagcaacctagaccttggcgtcagcgcgttttatgacgagcaaactgag
cgggtttcgatcatgaaaaaagagacgggggcgcgggcgagccttgtgctcgccgaccag
gcgacggctgacttttttgcgcaaaagctcgggtttgcgggcgcgatagcggggcaggag
cttacgggaaaaacggcggggaaagacgccgacattaccatcaacggcttgcaaacgacc
cgctcgtcgaacacatttacgatcaacggcgtgacgtacacgctcaaagggacaggcgcg
gcgacggtgtcggtggcgacggacgcggacgcgatgtttaacgccattaaagggtttgtc
gacaaatacaacgaaacgatcgacaaaatcaacgccgagctgaaagaggagcgctaccgc
gactacccgccgcttaccgacgagcaaaaggaagcgatgacggagaaacaaattgagctg
tgggaagaaaaggcgcggagcgggatgcttcgcggtgattcgattttgtcgagcgccttg
agccaaatgcggatgaatgtgtacacgaaagtcgaaggagcgaacattccaagcgggttt
tcgcagctcgcgcaaatcgggattacgacgtcgtcgaattatctagacggcgggaagttg
atcattgacgaaacgaagctgcgggagaaaatcaaggaaaacccggatgccgtctatcag
ttgtttaaccaagacggtgcgacggatgcggaaaaagggatcgcccgccgcctgcgcgat
acgatcaaagcgacgatcgggaaaatcgagcaaaaggcggggaagacgatttggacgaac
cagcagtttgcgatcgggcgcgatttaatccagatcaatgaccaaattgaccgcttccaa
gaccgtttgaaacaaattgaagaccgctactaccgccaattcacggcgatggaagaagcg
attcagcgcgccaaccaacaaagcatgtacttgatgaacgcctttggcggcggcatgcag
gggtaa

DBGET integrated database retrieval system