KEGG   Geobacillus sp. JS12: A0V43_13560Help
Entry
A0V43_13560       CDS       T04412                                 

Definition
(GenBank) hypothetical protein
Organism
gej  Geobacillus sp. JS12
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DZR zinc-ribbons_6 TackOD1 zf-C4pol AbiEi_4 zf-dskA_traR RecR Ribosomal_L32p DUF2039
Motif
Other DBs
NCBI-ProteinID: AMQ21732
UniProt: A0A142D3Y0
LinkDB All DBs
Position
complement(2755568..2755978)
Genome map
AA seq 136 aa AA seqDB search
MAELANCSKCGRLFVKLSTRDVCESCYQEEERQFERVYAFLRRRENRTATMAQVVEATGV
EEKLIIKWIRAGRLQLVHFPNLGYPCDSCGAMIREGRLCAKCLGQLQADLRRAEGEKEKE
ARSRRATYYSQDHKER
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcggaactagccaattgttccaagtgcgggcggttgtttgtcaagttatcgacccgc
gacgtatgcgagtcgtgctatcaagaagaagaacggcaatttgaacgcgtttacgcgttt
ttgcgcagacgggaaaaccgcacggcgacgatggcgcaagtggtggaggcgacaggggtg
gaggagaagctgatcattaaatggattcgcgcagggcggttgcagcttgttcatttcccg
aatctcggctacccgtgcgactcgtgcggtgcgatgatccgtgaagggcggttgtgcgcc
aagtgcctcggccagctgcaagccgacttgcggcgggcggagggggaaaaggaaaaagaa
gctcgttcccgccgcgccacttattacagccaagatcataaagagcgctaa

DBGET integrated database retrieval system