KEGG   Geobacillus sp. JS12: A0V43_16590Help
Entry
A0V43_16590       CDS       T04412                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
gej  Geobacillus sp. JS12
Pathway
gej00473  D-Alanine metabolism
gej01100  Metabolic pathways
gej01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gej00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A0V43_16590
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    A0V43_16590
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gej01011]
    A0V43_16590
Enzymes [BR:gej01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     A0V43_16590
Peptidoglycan biosynthesis and degradation proteins [BR:gej01011]
 Precursor biosynthesis
  Racemase
   A0V43_16590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AMQ22200
UniProt: A0A142D598
LinkDB All DBs
Position
3372820..3373974
Genome map
AA seq 384 aa AA seqDB search
MDEFHRDTWVEIDLDAIYDNVANLRRFLPEGTQIMAVVKANAYGHGDAQVAATALEAGAS
RLAVAFLDEALALRKKGIDAPILVLGASRPEDVALAAEHRIALTVFRSDWLEKASSLYNG
STPIHFHLKMDTGMGRLGVKDEEETKRIAALIDRHPPFVLEGVYTHFATADEVNTDYFSY
QYARFLHMLDWLPLRPPLVHCANSAAALRFSDRAFNMVRFGISMYGLAPSPDIKPLLPYE
LKEAFSLHSRLVHVKKLQPGEKVSYGATYTAQTEEWIGTIPIGYADGWLRRLQHFHVLVG
GRWAPIVGRICMDQCMIRLPEPLPVGTKVTLIGRQGDEVISIDDVARHLDTINYEVPCTI
SYRVPRIFFRNKRIMEVRNAVGRG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggacgagtttcaccgcgatacgtgggtggaaattgatttggacgccatttacgacaac
gtcgcgaatttgcgccgctttttgccggagggtacgcaaattatggccgttgtcaaggcg
aacgcctacgggcacggcgatgcccaagtggcggcaacggcgctcgaagcgggcgcttcc
cgcttggccgtcgcctttttggacgaggcgcttgccttacgaaaaaaaggcatcgatgcc
ccgattttagtgcttggggcgtctcgtcccgaggatgtggcgttggccgccgaacaccgc
atcgccttaaccgtgtttcgctctgattggctcgagaaggcgtcatcgctgtataacggt
tcgaccccgattcatttccatttaaagatggacacgggaatgggacggcttggggtgaaa
gacgaagaggagacaaagcgaatagcggccttgatcgatcgccatccgccctttgtgctt
gaaggggtgtatacgcattttgcgaccgctgatgaagtgaatacggattacttttcttat
caatacgcccgctttttgcatatgcttgactggctgccgttgcggccgccgctcgttcat
tgcgccaacagcgcggcggcccttcgtttttccgatcgagcgttcaacatggttcgcttt
ggcatttcgatgtacgggctcgccccatcgccggacatcaagccgctcctcccatacgaa
ttgaaagaggcgttttcgctccatagccgccttgtacacgtcaaaaaactgcaaccaggc
gaaaaggtgagctacggtgcgacgtacaccgcgcagacggaagagtggatcggcacgatt
ccaatcggttatgcggacggctggctgcgaaggttgcaacactttcatgtgcttgttggc
gggcggtgggcgccgatcgtcggccgtatctgcatggatcaatgcatgatccgcctgcct
gagccgctgcctgtcgggacgaaggtgacattaattggccgccaaggggacgaagtcatt
tccatcgatgatgtcgcccgccatttggacacaatcaattatgaagtgccgtgcacgatc
agctaccgggtgccccgtatttttttccgaaataagcgtataatggaagtgagaaatgcc
gttggccgcggatga

DBGET integrated database retrieval system