KEGG   Geobacillus sp. JS12: A0V43_17260Help
Entry
A0V43_17260       CDS       T04412                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
gej  Geobacillus sp. JS12
Pathway
gej00970  Aminoacyl-tRNA biosynthesis
gej01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gej00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A0V43_17260
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gej03029]
    A0V43_17260
Enzymes [BR:gej01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     A0V43_17260
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     A0V43_17260
Mitochondrial biogenesis [BR:gej03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    A0V43_17260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AMQ22298
UniProt: A0A142D5J6
LinkDB All DBs
Position
3488002..3489432
Genome map
AA seq 476 aa AA seqDB search
MNFETVIGLEVHVELKTKSKIFSSSPNAFGAPPNTQTNVIDLGYPGVLPVLNRQAVEFAM
KAAMALNCEIATETKFDRKNYFYPDNPKAYQISQYDQPLGKNGWIEIEVNGKKKKIGITR
IHLEEDAGKLTHTGDGYSLVDFNRQGTPLIEIVSEPDIRSPEEAYAYLEKLKAIIQYTGV
SDCKMEEGSLRCDANISLRPIGSDQFGTKTELKNLNSFNFVRMGLEYEAKRQEKILLSGG
VIRQETRRFDEATKTTVLMRVKEGSEDYRYFPEPDLVMLYIDDEWKERVRASIPELPDAR
RKRYVEEWGLPEYDAKVLTLTKEMADFFEATVANGADPKLASNWLMVEVSGYLNAEQKEL
HDIALTPESLAGMIKLIQNGTISSKIAKKVFKELVEKGGDPEKIVKEKGLVQISDEGALR
KIVLEVLDANPQSVEDYKNGKDRALGFLVGQVMKATKGQANPPLVNKLLVEEIGKR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgaaacggtcatcggacttgaggtgcacgtcgagctgaaaacgaaatcgaaa
attttctccagcagcccgaacgcgttcggcgcgcccccgaacacgcaaacgaacgtcatc
gacttagggtatccaggcgtgctgccggtgttgaaccggcaggcggtcgagtttgcgatg
aaagcggcgatggcgttaaactgcgaaatcgcgaccgagacgaaattcgaccgcaaaaac
tacttttatccggacaacccgaaagcgtaccaaatttcgcaatacgatcagccgctcggc
aaaaatggctggattgaaattgaagtgaatgggaaaaagaaaaaaatcggcatcacccgc
attcacttggaagaagacgccggcaagctgacacatacgggcgacggctattcgctcgtt
gattttaaccgccaagggacgccgctcatcgagatcgtctcggaaccagacatccgctcg
ccggaagaggcgtacgcctacttggaaaaattaaaggcgatcatccaatacacaggcgtc
tccgactgcaaaatggaagaaggatcgctccgctgcgacgccaacatttcgctccggccg
atcggatcggaccaattcggcacgaaaacggagttgaaaaacttaaactcgtttaacttc
gtccgcatggggctcgagtacgaagcgaagcggcaggagaaaattttgctctccggcggc
gtcatccgccaagaaacgcggcgctttgacgaagcgacgaaaacgaccgtcctcatgcgc
gtcaaagaaggctcggaagactatcgctacttcccggagccggacttggtcatgctttat
attgacgacgaatggaaagagcgcgtccgcgcctcgattccggagctgccggacgcccgc
cggaagcggtatgtcgaagaatggggcctgccggaatacgacgccaaagtgctgacgctg
accaaagaaatggcggatttcttcgaagcaacggtcgcaaacggcgccgatccgaaactg
gcgtcgaactggctcatggtcgaagtgtccgggtacttaaacgccgaacaaaaagagctg
catgacatcgccttgacgccggaaagcctagcaggcatgatcaaactcatccaaaacggc
acgatttcgtcgaaaatcgcgaaaaaagtgttcaaagagcttgttgaaaaaggcggcgac
ccggagaaaatcgtcaaagaaaaagggctcgtgcaaatttccgacgagggagcgctgcgc
aaaatcgtgctcgaagtgcttgacgccaacccgcagtcggtcgaagactataaaaacggc
aaagaccgcgcgctcggcttccttgtcggccaagtgatgaaagcgacgaaaggacaagcg
aatccgccgcttgtcaataagctgttagtagaggaaattggaaaacgataa

DBGET integrated database retrieval system