KEGG   Geobacillus sp. LC300: IB49_02535Help
Entry
IB49_02535        CDS       T04018                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
gel  Geobacillus sp. LC300
Pathway
gel00564  Glycerophospholipid metabolism
gel01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    IB49_02535
Enzymes [BR:gel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     IB49_02535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored NAD_binding_8 Pyr_redox_2 3HCDH_N FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AKU25531
UniProt: A0A0K1K8I3
LinkDB All DBs
Position
complement(487383..489065)
Genome map
AA seq 560 aa AA seqDB search
MAFSSKHRSDVLQAMSEKQYDLLIIGGGITGSGIALDAISRGMTVALVEMQDFAAGTSSR
STKLVHGGLRYLKQFEVKLVAEVGRERAIVYENGPHVTTPEWMLLPIYRGGTFGKWSTSV
GLWLYDRLAGVKPSERRTMLDARQTLEKEPLLKRDGLLGGGYYVEYRTDDARLTIEVVKK
AVELGVDAVNYVKAEQFLYDERGRITGARCRDLIGGRVYDIRAKKVVNAAGPWVDALRDK
DGSKTGKRLRLTKGVHIVIDQKRFPLKQAVYFDTPDGRMVFAIPRDGKTYVGTTDTFYDD
DPAHPAMTEEDRDYLLQAIHYMFPSVGVTADDVESSWAGVRPLIYEEGKDPSEISRKDEI
WTSPSGLITIAGGKLTGYRKMAETVVDLVAKQLEKEEGKTFRPCQTKQLPISGGDVGGSH
RLPAFIAEKAKEAARYGLTEEQGARLAKQYGTNVDRLFALSQQYDRSSGLTRETFVRLVY
AIEEEMAAKPVDYFIRRTGALLFDIDAVRREKEAVIAFMARHLGWTGEERDMYQKELDKE
LQRAVLGTSGVNDLLKEMSA
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctcaagcaaacatcggagcgatgttcttcaagcgatgagcgaaaaacaatat
gatcttctgatcatcggtggagggatcaccggctctggcatcgcccttgatgccatctcg
cgcggcatgacggtcgcgcttgtcgagatgcaagatttcgccgccggcacgtcgagccgc
tcgaccaaactcgtccacggcggcctgcgctacttgaagcagttcgaggtgaagcttgtc
gcggaagtcgggcgcgaacgggcgattgtgtatgaaaacggcccgcacgtcaccacaccg
gagtggatgctgctgcccatttatcgcggcgggacgttcggcaaatggagcacgtcggtc
ggcctttggctgtatgaccggctggctggcgtcaagccaagcgagcggcgcacgatgctt
gatgcccggcagacgttggaaaaagagccgctcttaaagcgcgatggcctccttggcggc
ggctattacgtcgagtatcggaccgacgatgcccgcttgacgatcgaggtggtcaaaaaa
gcggtcgagcttggcgtcgacgccgtcaactacgtaaaagccgaacagtttttgtatgac
gagcgcggccgcatcaccggcgctcgctgccgcgacctgatcggcggacgagtgtatgac
atccgcgccaaaaaagtcgtcaatgccgccggaccatgggttgatgcgctgcgcgacaaa
gacggatcgaaaaccggcaagcggcttcggctgaccaaaggcgtccacatcgtcatcgat
caaaagcggtttccgctcaagcaggcagtctattttgacaccccggacggccggatggtg
tttgccattccgcgggatgggaaaacgtatgtcggcacgaccgatacattttatgacgat
gatcccgctcatccggccatgactgaagaagaccgcgactacttattgcaggcgattcac
tacatgttcccgtccgtcggcgtcactgccgacgatgtcgagtcgagctgggctggcgtc
cgtccgctcatttatgaagaagggaaagacccgtcggaaatttcccgcaaagacgagatt
tggacgtcgccgtccggcctcattacgatcgccggcggcaaactgaccggctaccggaaa
atggcggaaacggtcgttgacctcgtcgccaaacaattggaaaaagaagagggaaaaacg
ttccgcccgtgccaaacgaaacagctgccaatttccggcggcgatgtcggcggctcgcat
cggctgccggccttcatcgccgaaaaggcgaaggaagcggcgcgctatgggctgacagaa
gaacaaggggcgcggctggcaaaacagtacggcacaaatgtcgaccggctgtttgcgtta
agccagcaatacgaccgctcgtccggcttaacgcgtgaaacgttcgtccgcctcgtctac
gccattgaggaagaaatggcggccaaaccggtcgactacttcatccgccgcaccggggcg
ctgctgtttgacatcgacgccgtccggcgggaaaaagaagcggttatcgcgtttatggcg
cggcatttggggtggacgggggaagagcgggacatgtatcagaaggaactcgacaaggaa
ctgcagcgcgcggtgttggggacgagcggagtgaatgatctgttgaaggaaatgagcgcc
tga

DBGET integrated database retrieval system