KEGG   Geobacillus sp. LC300: IB49_03790Help
Entry
IB49_03790        CDS       T04018                                 

Definition
(GenBank) acetyl-CoA carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
gel  Geobacillus sp. LC300
Pathway
gel00061  Fatty acid biosynthesis
gel00620  Pyruvate metabolism
gel00640  Propanoate metabolism
gel01100  Metabolic pathways
gel01110  Biosynthesis of secondary metabolites
gel01120  Microbial metabolism in diverse environments
gel01130  Biosynthesis of antibiotics
gel01200  Carbon metabolism
gel01212  Fatty acid metabolism
Module
gel_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:gel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    IB49_03790
   00640 Propanoate metabolism
    IB49_03790
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    IB49_03790
Enzymes [BR:gel01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     IB49_03790
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     IB49_03790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 RimK GARS_A Oxidored_nitro LAL_C2 ATP-grasp_5 Ntox43 ATPgrasp_Ter ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AKU25717
UniProt: A0A0K1K8K9
LinkDB All DBs
Position
complement(707678..709033)
Genome map
AA seq 451 aa AA seqDB search
MIKKVLVANRGEIAVRIIRACRELGIETVAVFSQADRDALHVQLADEAYCIGPTASKDSY
LNFTNIMSVATLTGCDAIHPGYGFLAENEAFAELCRECNVTFIGPSPEAIAKMGIKDIAR
ETMREAGVPIVPGSRGVIESLEEARAIAAEIGYPVIIKATAGGGGKGIRVARNEEELVKG
INITQQEAATAFGNPGVYIEKYIEDFRHVEIQVLADSYGNTIHLGERDCSIQRRLQKLVE
EAPSPALDDDMRRRMGEAAVKAAKAVNYTGAGTVEFIYDHRNKQFYFMEMNTRIQVEHPV
TELITGVDLVKEQIRVAAGEKLSLTQEDVSFNGWAIECRINAENPAKNFMPSPGKIAMYL
PPGGPGVRVDSAAYPGYTIPPYYDSMIAKLIVHAPTREEAIARMRRALSEFVIEGIHTTI
PFHIKLMEHEKFQSGEFNTKFLELYDIMKAE
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaagtgttggtggcgaaccgcggggaaatcgccgtccgcattattcgcgcc
tgccgggagctcggcattgagacggtcgccgtcttttcgcaggctgaccgcgacgccttg
catgtgcagctggcggatgaggcgtactgcatcgggccgaccgcctcgaaagacagctat
ttgaatttcaccaacatcatgagcgttgccacgttgaccggctgtgacgccattcacccg
ggctatggctttttggcggagaacgaggcgtttgccgagctgtgccgcgaatgcaatgtc
acgttcatcggcccgagcccggaagcgatcgccaaaatggggattaaagacatcgcccgc
gagacgatgagggaagcgggtgtgccgattgtgccgggctcgcgcggcgttattgaaagt
cttgaggaggcgcgggcgatcgccgctgaaatcggttacccggtcatcatcaaagcgacg
gccggcggcggtgggaaaggaattcgcgtcgcccgcaacgaagaagagctcgtcaaaggc
atcaacatcacccagcaagaagcggcgacggcgttcggcaaccctggcgtttatattgaa
aagtatatcgaagatttccgccatgtcgaaattcaagtgctcgccgattcatatggcaac
accattcatttaggagagcgcgactgctcgatccagcgccggctgcaaaagcttgtcgaa
gaagcgccgtcgccggcccttgacgacgacatgcgccggaggatgggcgaggcggcggtc
aaggcggccaaggcggtcaactacacgggcgccggcacggttgaatttatttatgaccac
cggaacaaacagttttatttcatggaaatgaatacgcgcattcaggtggagcacccggtc
accgagctcattaccggtgtcgatttagtaaaagaacagatccgcgtcgctgccggtgaa
aagctgtcgctcacccaagaggacgtctcctttaacggttgggcgatcgaatgccgcatc
aatgcggaaaacccagcgaaaaactttatgccgtcgccggggaaaatcgccatgtacttg
ccgccgggcggtccgggcgtgcgcgtcgattccgccgcctacccgggctatacgattccg
ccgtattacgattcgatgatcgccaaactgatcgttcacgcgccgacgcgtgaggaggcg
atcgcccgcatgagacgggctctttcggaatttgtcattgaaggcattcatacgacgatc
ccgtttcacataaaattaatggaacacgagaaattccaaagcggcgagtttaatacgaag
tttttggagttatatgatattatgaaggcggaatag

DBGET integrated database retrieval system