KEGG   Geobacillus sp. LC300: IB49_04090Help
Entry
IB49_04090        CDS       T04018                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
gel  Geobacillus sp. LC300
Brite
Enzymes [BR:gel01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     IB49_04090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N AHSP
Motif
Other DBs
NCBI-ProteinID: AKU25769
UniProt: A0A0K1K8Q5
LinkDB All DBs
Position
complement(760030..760644)
Genome map
AA seq 204 aa AA seqDB search
MPFELPALPYPYDALEPHIDKETMNIHHTKHHNTYVTNLNAALEGHPDLQNKSLEELLSN
LEALPESIRTAVRNNGGGHANHSLFWTILSPNGGGEPTGELAEAINKKFGSFTAFKDEFS
KAAAGRFGSGWAWLVVNNGELEITSTPNQDSPIMEGKTPILGLDVWEHAYYLKYQNRRPE
YIAAFWNIVNWDEVAKRYSEAKAK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgccatttgaattgccagcattgccgtatccgtatgatgcgcttgagccgcacatcgac
aaagaaacgatgaacattcaccatacgaagcaccataacacatacgttacaaatttgaat
gcggcgcttgaagggcatccggatttgcaaaacaaatcgctcgaagaattgctcagcaat
ttggaagcccttccggaaagcattcgcacggcggtgcgcaacaacggcggcggtcatgca
aaccactcgcttttctggacgattttgtcgccaaatggcggcggtgagccgacgggtgag
ctggctgaggcgatcaacaaaaaattcggcagcttcaccgcgtttaaagacgagttttcg
aaagcagcggccggccgtttcggttctggctgggcatggcttgtcgtgaacaacggcgag
ctggaaattacgagcacgccgaaccaagactcgccgattatggaaggcaaaacgccgatt
ctcggcttggacgtttgggagcatgcgtactacttgaaataccaaaaccgccgtccggaa
tacattgccgcattctggaacattgtcaactgggacgaagtggcgaaacggtacagcgaa
gcgaaagcgaagtaa

DBGET integrated database retrieval system