KEGG   Geobacillus sp. LC300: IB49_05585Help
Entry
IB49_05585        CDS       T04018                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gel  Geobacillus sp. LC300
Pathway
gel00010  Glycolysis / Gluconeogenesis
gel00030  Pentose phosphate pathway
gel00051  Fructose and mannose metabolism
gel00052  Galactose metabolism
gel00680  Methane metabolism
gel01100  Metabolic pathways
gel01110  Biosynthesis of secondary metabolites
gel01120  Microbial metabolism in diverse environments
gel01130  Biosynthesis of antibiotics
gel01200  Carbon metabolism
gel01230  Biosynthesis of amino acids
gel03018  RNA degradation
Module
gel_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gel_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:gel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IB49_05585
   00030 Pentose phosphate pathway
    IB49_05585
   00051 Fructose and mannose metabolism
    IB49_05585
   00052 Galactose metabolism
    IB49_05585
  09102 Energy metabolism
   00680 Methane metabolism
    IB49_05585
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    IB49_05585
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:gel01009]
    IB49_05585
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:gel03019]
    IB49_05585
Enzymes [BR:gel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     IB49_05585
Protein phosphatases and associated proteins [BR:gel01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     IB49_05585
Messenger RNA biogenesis [BR:gel03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     IB49_05585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase PucR Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: AKU26036
UniProt: A0A0K1K9Z2
LinkDB All DBs
Position
complement(1050274..1051233)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRSVVRKAIYHGVEVYGVYHGYAGLIAGNIKKLEVGDVGDI
IHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWS
GLAGGAETILIPEADYDMNDVIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQIQEATGF
ETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDHDIAEAL
ANKHTIDQRMYALSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgcattggtgtgttgacaagcggcggcgactcgccgggaatgaatgcggccatt
cgctcggttgtccgcaaagcgatttaccacggtgtggaagtgtacggcgtttatcacggg
tatgccggactgatcgccggcaacattaaaaagctggaagtcggcgatgtcggggatatt
atccaccgtggcggcacgatactctatacggcccgctgtccggaatttaagacggaagaa
ggtcagaaaaaagggatcgagcagctgaaaaagcacggcattgaagggctggtcgtcatc
ggcggcgacggttcgtaccaaggggcgaaaaaactgaccgagcacggctttccgtgcgtc
ggcgtgccggggacgattgacaacgacattccgggcactgattttacgatcgggtttgac
acggcgctcaatacggtcattgatgccatcgacaaaatccgcgacacggcgacgtcgcac
gagcggacgtacgtcatcgaagtgatgggccgccatgccggcgacatcgccttatggtcg
gggctggccggcggggcggaaacgattttaattccggaagccgattatgatatgaacgac
gtcatcgcccgcttaaagcgcggccatgagcgcggcaaaaaacatagtatcatcatcgtg
gcggaaggggttggaagcggcgtcgacttcggccggcaaatccaggaagcgaccggcttt
gagacgcgtgtgacggtgcttggccacgtgcagcgcggcgggtcgcccacggcgtttgac
cgcgtgctcgcgagccgcctcggcgcccgggcggtcgagctgttgctcgaaggaaaaggc
gggcgctgcgtcggcatccaaaacaaccagctcgtcgaccatgacatcgcggaggcgctg
gccaacaaacatacgatcgatcagcggatgtacgcattgtcgaaagaattgtccatttaa

DBGET integrated database retrieval system