KEGG   Geobacillus sp. LC300: IB49_08390Help
Entry
IB49_08390        CDS       T04018                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
gel  Geobacillus sp. LC300
Pathway
gel00010  Glycolysis / Gluconeogenesis
gel00620  Pyruvate metabolism
gel01100  Metabolic pathways
gel01110  Biosynthesis of secondary metabolites
gel01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IB49_08390
   00620 Pyruvate metabolism
    IB49_08390
Enzymes [BR:gel01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     IB49_08390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AKU26463
UniProt: A0A0K1KBC1
LinkDB All DBs
Position
1574942..1576462
Genome map
AA seq 506 aa AA seqDB search
MIYAQPGQPGALVTFKKRYENFIGGKWVPPVDGEYFENITPITGQPYCEVPRSKAADIEL
ALDAAHAAKDAWGRTSPAERARLLNKIADRMEENLEMLAVAETWENGKPIRETLAADIPL
AIDHFRYFASCIRAQEGTISEIDHDTVAYHFKEPLGVVGQIIPWNFPILMAAWKLAPALA
AGNCVVLKPAEQTPTSILVLIELIEDLLPPGVVNIVNGFGLEAGKPLASNPRVAKVAFTG
ETTTGRLIMQYASQNIVPVTLELGGKSPNIFFADVMDKDDDFLDKALEGFTMFALNQGEV
CTCPSRALIHESIYDAFMERALERVKQIKQGNPLDTETMIGAQASSEQLEKILSYIDIGK
QEGAELLIGGERNMLEGELSGGYYVKPTVFKGHNKMRIFQEEIFGPVLAVTTFKDHDEAL
SIANETLYGLGAGVWTRDINTAYRFGRGIQAGRVWTNCYHVYPAHAAFGGYKMSGIGRET
HKMMLDHYQQTKNLLVSYSPKKLGLF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgatctacgcacaaccaggccagccaggcgcgcttgtcacatttaaaaagcgctacgaa
aacttcattggcggcaaatgggtgccgccggtcgacggcgaatattttgaaaacattacg
ccgatcaccggacagccgtattgcgaagtgccgcgctcaaaagcggcggacatcgaactg
gcgcttgacgccgcccatgcggcaaaagacgcatggggacgcacgtctccggcagagcgc
gcccgtttgctgaacaaaatcgccgatcggatggaagaaaacttggaaatgctcgccgtt
gcggaaacatgggaaaacggcaagccgatccgcgagacgctcgcggctgacattccgctc
gccatcgaccatttccgctattttgccagctgcattcgcgcgcaagaaggcacgatttcg
gaaatcgatcacgacacggtcgcctatcatttcaaagaaccgctcggcgtcgtcggacaa
atcatcccgtggaacttcccgattttaatggcggcctggaagctcgctccagcgctcgcg
gccggcaactgcgtcgtcttgaaaccggcggagcaaacaccgacatcgatcctcgttctc
atcgaactcatcgaagatttgcttccacctggcgtcgtcaacatcgtcaacggctttggc
ttagaagccggcaagccgctcgcctcgaacccgcgcgtggcgaaagtggcgttcaccggc
gaaacgacgaccggacggctcatcatgcaatacgcctcgcaaaacatcgtgccggttacg
ctcgagctgggcggcaagtccccgaacattttcttcgctgatgtgatggacaaagacgat
gactttcttgataaagcgcttgaaggctttacgatgttcgccttaaaccaaggcgaagtg
tgcacatgcccgtcgcgcgccctcatccatgagtcgatttacgacgcctttatggaacgg
gcgcttgagcgcgtcaagcaaatcaagcaaggcaatccgctcgatacggaaacgatgatc
ggcgcccaagcctcctccgaacagctcgagaaaattttgtcatacatcgacatcggcaaa
caagaaggcgccgaacttttgatcggcggcgagcggaacatgctcgaaggagaactgtcc
ggcggctattacgtcaagccgaccgttttcaaagggcataacaaaatgcgcattttccaa
gaagaaattttcggcccagtgctcgcggtcacgacgtttaaagatcatgacgaagcgctt
tcgatcgccaatgagacgctgtacggccttggcgccggcgtctggacgcgcgacatcaac
accgcgtaccgcttcggccgcggcatccaggctggccgcgtctggacgaactgctaccac
gtctatccggcccatgcggcgttcggcggctacaaaatgtccggcatcggccgcgaaacg
cacaaaatgatgctcgaccattaccaacaaacgaaaaacttgctcgtcagctattcgccg
aaaaaactcggcttgttctaa

DBGET integrated database retrieval system