KEGG   Geobacillus sp. LC300: IB49_10540Help
Entry
IB49_10540        CDS       T04018                                 

Definition
(GenBank) heat shock protein Hsp33
  KO
K04083  molecular chaperone Hsp33
Organism
gel  Geobacillus sp. LC300
Brite
KEGG Orthology (KO) [BR:gel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:gel03110]
    IB49_10540
Chaperones and folding catalysts [BR:gel03110]
 Heat shock proteins
  HSP33
   IB49_10540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AKU26811
UniProt: A0A0K1KC74
LinkDB All DBs
Position
1987769..1988650
Genome map
AA seq 293 aa AA seqDB search
MGDYLVKALAYDGQVRAYAARTTETVAEAQRRHQTWPTASAALGRALTAGVMMGAMLKGD
ETLTIKIDGGGPIGTILIDSNAKGEVRGYVTNPHVHFELNEHGKLDVARAVGKNGMLTVV
KDLGLRDFFTGQVPIISGELGDDFTYYFASSEQIPSSVGVGVLVNPDYTIRAAGGFIIQL
MPGTEEQTISRIEERLKQIPPVSRMIENGLTPEQILEQILGGGVRVLETMPVSFVCRCSR
ERIADALISLGPGEIQDIIDKEGQAEASCHFCNETYHFDKAELEQLKQLAKKE
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgggagattacttagtcaaagcgctcgcctatgacggacaggtgagggcgtatgcggca
aggacgacggagacggtggcggaagcgcagcgccgccatcaaacgtggccgaccgcctcg
gcggcgctcggacgggcgctgacggccggcgttatgatgggagcaatgttaaaaggggat
gaaacgttgaccatcaaaattgatggcggcgggccgatcggcacgattttaatcgacagc
aatgccaaaggggaagtgcgcggctatgtgaccaatccgcacgtgcatttcgagctgaat
gaacacgggaaactcgatgtcgcgcgggcggtcggcaaaaacgggatgctgacggtcgtc
aaagacctcgggctgcgcgactttttcaccggtcaagtgccgatcatctcgggggagctc
ggcgacgatttcacctattatttcgcttcttccgagcaaatcccgtcgtccgtcggcgtc
ggcgtgctcgtcaaccccgattacacgatccgggccgcgggagggtttatcattcaattg
atgcctggaacggaagaacaaacgatcagccgcattgaggagcggttgaaacaaattccg
cctgtgtcgcgcatgattgaaaacggcctaacaccggagcaaatattggaacaaatttta
ggcggcggcgtccgggtgttggagacgatgccggtgtcatttgtctgccgctgttcgcgc
gagcggatcgcggatgcgctcatcagcctggggccaggggagattcaagatatcatcgac
aaggaagggcaggcggaagcgtcgtgccatttttgcaatgaaacgtaccatttcgacaaa
gcggagctggaacagttgaaacaactcgcaaaaaaagaatga

DBGET integrated database retrieval system