KEGG   Geobacillus sp. LC300: IB49_11415Help
Entry
IB49_11415        CDS       T04018                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
gel  Geobacillus sp. LC300
Pathway
gel00473  D-Alanine metabolism
gel01100  Metabolic pathways
gel01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gel00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    IB49_11415
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    IB49_11415
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gel01011]
    IB49_11415
Enzymes [BR:gel01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     IB49_11415
Peptidoglycan biosynthesis and degradation proteins [BR:gel01011]
 Precursor biosynthesis
  Racemase
   IB49_11415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AKU26942
UniProt: A0A0K1KC20
LinkDB All DBs
Position
2140961..2142127
Genome map
AA seq 388 aa AA seqDB search
MNDFHRDTWAEVDLDAIYDNVANLRRLLPDDTHIMAVVKANAYGHGDVQVARTALEAGAS
RLAVAFLDEALALREKGIEAPILVLGASRPADAALAAQQRIALTVFRSDWLEEASALYSG
PIPIHFHLKMDTGMGRLGVKDEEETKRIAALIERHPHFVLEGVYTHFATADEVNTDYFSY
QYTRFLHMLEWLPSRPPLVHCANSAASLRFPDRTFNMVRFGIAMYGLAPSPGIKPLLPYP
LKEAFSLHSRLVHVKKLQPGEKVSYGATYTAQTEEWIGTIPIGYADGWLRRLQHFHVLVD
GQKAPIVGRICMDQCMIRLPGPLPVGTKVTLIGRQGDEVISIDDVARHLETINYEVPCTI
SYRVPRIFFRHKRIMEVRNAIGRGESSA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacgactttcatcgcgatacgtgggcggaagtggatttggacgccatttacgacaat
gtggcgaatttgcgccgtttgctgccggacgacacgcacattatggcggtcgtgaaggcg
aacgcctatggacatggggatgtgcaggtggcaaggacagcgctcgaagcgggggcctcc
cgcctggcggttgcctttttggatgaggcgctcgctttaagggaaaaaggaatcgaagcg
ccgattctagttctcggggcttcccgtccagctgatgcggcgctggccgcccagcagcgc
attgccctgaccgtgttccgctccgactggttggaagaagcgtccgccctttacagcggc
cctattcctattcatttccatttgaaaatggacaccggcatgggacggcttggagtgaaa
gacgaggaggagacgaaacgaatcgcagcgctgattgagcgccatccgcattttgtgctt
gaaggggtgtacacgcattttgcgactgcggatgaagtgaacaccgattatttttcctat
cagtatacccgttttttgcacatgctcgaatggctgccgtcgcgcccgccgctcgtccat
tgcgccaacagcgcagcgtcgctccgtttccctgaccggacgttcaatatggtccgcttc
ggcattgccatgtatgggcttgccccgtcgcccggcatcaagccgctgctgccgtatcca
ttaaaagaagcattttcgctccatagccgcctcgtacacgtcaaaaaactgcaaccaggc
gaaaaggtgagctatggtgcgacgtacactgcgcagacggaggagtggatcgggacgatt
ccgatcggctatgcggacggctggctccgccgcctgcagcactttcatgtccttgttgac
ggacaaaaggcgccgattgtcggccgcatttgcatggaccagtgcatgatccgcctgcct
gggccgctgccggtcggcacgaaggtgacactgattggtcgccagggggacgaggtgatt
tccattgatgatgtcgctcgccatttggaaacgatcaactacgaagtgccttgcacgatc
agttatcgagtgccccgtatttttttccgccataagcgtataatggaagtgagaaacgcc
attggccgcggggaaagcagtgcataa

DBGET integrated database retrieval system