KEGG   Geobacter sp. M21: GM21_0109Help
Entry
GM21_0109         CDS       T00933                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
gem  Geobacter sp. M21
Pathway
gem03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:gem00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    GM21_0109
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gem03400]
    GM21_0109
Enzymes [BR:gem01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     GM21_0109
DNA repair and recombination proteins [BR:gem03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     GM21_0109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ACT16195
UniProt: C6E8Q6
LinkDB All DBs
Position
complement(132915..135533)
Genome map
AA seq 872 aa AA seqDB search
MGLEEYQRKRNPERTPEPPAGEGKSDRSLRFVVHMHAASHLHYDFRLELDGVLKSWAIPK
GPSLDPSVKRLAMMVEDHPYDYGDFEGVIPKGNYGAGEVIVWDAGSYEAPGAADLEQNMR
LLREGLKKGDLKFVLSGRKLNGEYALVRIKGDKENTWLLIKKNDRYASAEDVTLQDRSVV
SGVTIEEVRAGRKPQAPAATAEAAEPVGPVGPVGPAAPMPHRLTPMLARSAAEPFDDPDW
LFEIKLDGYRAIAEIEDGEALLYSRNNLSFNKRFPAIVQSLASLPVTAVLDGEVVALDEK
GRSYFQLLQNNRRTGEGNIYYYAFDLLYVDGEDLRAEPLEARKERLRSLLPELPWVRFGD
HIREYGRQFFELARENNLEGILAKRADSRYLAGRRSGDWLKIKIRLQQEAVICGFTQPRG
SRKGLGSLVLGVYENDELVYIGLTGGGFDDAGLKEMYAALQLLVQPESPFRQQVKTSMPA
TWVKPVLVCEVEFAEWTDENVMRQPIFLGLREDKDPRSVQREIFPAEVQPPVHRARTDHE
EDADEPAAGEKVPAEETVATANPSGNKGSKKGEVNLVIDGQRLTLTNLDKVFWPEEGYTK
GDVIDYYRKMARVILPYLVDRPESMYRTPHGITEGGFYQKETGDLIPPWITAREIYSKHV
DKNIKFLVCQNEATLIYMANLGCIEINPWLSRLQQLNHPDYLVIDLDPEDIAFEKVVETA
LAVHEVLESAGAVSFPKTSGATGIHIYVPLGARYDYDTAGGFAKLVATLAHHKVPGFTSL
LRSPRQRQKKVYLDFLQNKPGQTLAAPYSIRPRPGATVSTPLRWEEVKPGLDPRQFTIDT
IGKRLEQVGDLFQGVLGPGIDMEQCLERLQNG
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atgggtctggaagagtatcagcgcaaaaggaatccggagaggacgccggagccgccggcc
ggcgaggggaagtcggatagatctttgcggttcgtggtgcacatgcacgcggcctcccat
ctgcattacgacttcaggctggagctcgatggcgttctgaagagctgggccatccccaag
ggaccctcgctggacccatcggtgaaaaggctcgccatgatggtggaggaccatccctac
gactacggcgacttcgagggggtcatccccaaggggaattacggggcaggcgaggtgatc
gtctgggacgctggaagctatgaagcgccgggagcagccgatctggagcagaacatgcgg
ctgctgcgcgagggtctgaagaagggagacctgaagttcgtgctctccggccggaaactg
aacggggaatacgccctggtgcgcatcaagggggacaaggagaacacctggcttttgatc
aagaaaaacgaccggtatgcctcggccgaggacgtgacgctgcaggaccgttccgtggtc
agtggggtcaccatcgaggaggtgagggcggggaggaagccgcaggcgccagcggcaacc
gcggaggccgcggaacctgtcggacctgtcggacctgtcggacctgccgctccgatgccg
caccgccttacaccgatgctggcccgctccgcggccgagcccttcgacgatccggactgg
ctcttcgagataaaactcgacggttaccgcgccatcgccgagattgaggacggcgaggcc
ctcctttattcgcgcaacaacctctccttcaacaaacgcttccccgcaatcgtccagtca
ctggcttccctgccggtcacggcagtgctggacggcgaggtggtggccctcgacgaaaag
ggacgctcttacttccagctcttgcagaacaaccggcgcaccggagaggggaacatctac
tactacgccttcgacctcctctacgtcgacggcgaggacctgcgcgccgaaccgcttgag
gcacgcaaggagagacttcgctccctgctccccgaacttccctgggtccgcttcggcgac
catatcagggagtacggcaggcagttcttcgagctcgcccgtgagaacaacctggagggg
atcctcgccaaaagggcggacagccggtatttagcggggagaagaagcggcgactggctg
aagataaagatacggctgcagcaggaggcggtcatctgcggattcacccagcccaggggg
agcaggaaaggattgggctccctggtgctgggggtctacgaaaacgacgagttggtttac
atcgggcttaccggaggggggttcgacgacgcgggattgaaggagatgtacgccgctttg
cagctgctcgttcagccggagtcccctttccggcagcaggtgaagaccagcatgccggcc
acctgggtcaagccggtgctggtctgcgaggtcgaattcgccgaatggaccgacgagaac
gtcatgcgccagcctatcttcctggggcttcgggaggacaaggacccccggtccgtgcag
cgtgagatctttcccgccgaggtccagccccctgtccaccgtgcgcggacggatcatgag
gaggatgctgatgagccggcggcaggggaaaaggtgcctgcagaggagacggttgccacg
gccaatccttccggcaataaaggctcgaagaaaggggaggtgaacctcgtcatcgacgga
cagcggctcaccctcaccaacctggacaaggtcttctggccggaggagggatacaccaag
ggggacgtcatcgactactaccgtaagatggcgcgggtgatactcccctacctcgtggac
cgcccggagtcgatgtaccgcaccccgcacggcatcacggaaggagggttctaccagaag
gagacgggcgacctgatccccccctggatcaccgcccgggaaatctattccaagcacgta
gacaagaacatcaagttcctggtctgccagaacgaagcgacgcttatctacatggccaac
ctggggtgcatcgagatcaacccctggctgtcgcggctgcagcagctcaatcatcccgat
tacctggtgatcgacctggaccccgaggacatcgccttcgagaaggtggtcgagaccgcg
ctcgccgtgcacgaggtcctggagagcgcgggcgcggtcagtttcccgaagacctccggc
gccaccggcatccacatctacgtcccgctgggagcccgctacgactacgacacggcgggg
ggcttcgcgaagctggtggcgacgctcgcgcaccacaaggtccccggcttcaccagcctc
ttgcgcagcccgaggcagcgccagaaaaaggtgtacctcgacttcctgcagaacaagccc
ggccagaccctcgccgccccctacagcatccgcccccgccccggggcgaccgtttccacc
ccgctcaggtgggaggaggtgaagcccggtctcgacccgcgccagttcaccatcgacacc
atcgggaagcggcttgagcaggtcggcgacctgttccaaggcgtgctcggccccggtatc
gacatggaacagtgcctggagcgactgcaaaacgggtag

DBGET integrated database retrieval system