KEGG   Geobacter sp. M21: GM21_0117Help
Entry
GM21_0117         CDS       T00933                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
gem  Geobacter sp. M21
Pathway
gem00500  Starch and sucrose metabolism
gem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GM21_0117
Enzymes [BR:gem01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     GM21_0117
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     GM21_0117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C APH DUF3459
Motif
Other DBs
NCBI-ProteinID: ACT16203
UniProt: C6E8R4
LinkDB All DBs
Position
146614..149964
Genome map
AA seq 1116 aa AA seqDB search
MPQRSDKNPLWFKDAIVYEVHIRSFCDSNGDGIGDFRGLLQKLPYLRDLGITAVWVLPFY
PSPLKDDGYDIADYRSVHPDYGTLRDFQDFLKGAHALGMRVITELVLNHTSDQHPWFQKS
RTSKPGSPWRDFYVWSDTPDKYLDARIIFKDFEVSNWTRDPVAKSYFWHRFYSHQPDLNY
DNPRVHEAMFRVIDFWLGMGVDGLRLDAVPYLYEREGTNCENLPETYEFLKKLRAYIDAK
YPDRMLLAEANQWPEDAASYFGGGAACQMCFHFPLMPRMFMALQMEDSFPIINILQQTPV
IPQQCQWALFLRNHDELTLEMVTDEERDYMYRIYARDPRARINLGIRRRLAPLMGDDRRK
IELMNVLLFCLPGTPIIYYGDEIGMGDNYYLGDRNGVRTPMQWSPDRNAGFSPVNPQKLY
LPAIIDPEYHYEARNVENQAKNPSSLLWWMKRMIDLRKRFKAFGWGSVEFMPLENSKVLA
MVRKYEDQAILVLINLSRATQFVQVNQPRFVGFYPEEMFSRNRFPVIKDSPYGVILGAYD
YHLLLMKDGSEEVKPREEGVLEEVPVTGSWENVLRSAGLRQLEQSVLPEYLKRSRWFQGK
SRIMVRFSVMEKIPVPVNSSSVILTLLEVSYSEGAPETYLLPLHFVPMDGGGEGILTETP
AAVVCKLRIGDKVGILYDGTYNSHFRWALFEMIWRRKAIRTDGGRFSGRPASGMGALMEG
KEPPFVSQVGKSEQSNTSMLFDKHFFLKLYRRLEEGAHPEVEIGRFLSDRIRFQHVAPLA
GTIEYRRPGLEPVAIGMLQAFVPNQGDAWAFTLGEAGQFVDRVLAHREEAKESGTPAVSQ
PDTAATGFSTVLHDLIQGLYPEMVTLIGKRTAELHLALSSRSDDPSFAPEPFALLYQRSV
YQSMRSRTRKAFDLLRRNLGRLPQELVQEAEALLGMEPEVQGALQKFTISKFSAMKTRVH
GDYHLGQLLYTGDDFLIMDFEGEPVKSLGERRIKQSPLRDVAAMMRSFEYAGHAVLMQRT
QVREEDVAFLLPWIQAWCRYNSSLFLASYQKKVEGCNFMPDNPQDVETMLRCFMLDKAVY
ELGYELNNRPDWVSIPLRGIMNLLASEKSVPKLEGQ
NT seq 3351 nt NT seq  +upstreamnt  +downstreamnt
atgccacagcgcagcgacaaaaacccgctctggttcaaggacgccatcgtctacgaggtg
cacatcaggagtttctgcgacagcaacggggacggcatcggagacttccgggggctgttg
caaaaactcccctacctgcgcgacctggggatcaccgccgtctgggtgctccccttctac
ccctcgccgcttaaggacgacggctacgacatcgccgactaccgcagcgtccacccggac
tacggcaccctgcgcgacttccaggacttcctgaagggcgcccacgccctcggcatgcgg
gtcatcaccgagctggtcttaaaccacacctcggaccagcatccctggttccagaaatcc
cgcacctctaagcccggctccccctggcgcgacttctacgtctggtccgacacccccgac
aagtacctggacgcccgcatcatcttcaaggatttcgaggtctccaactggacccgcgat
cccgtcgccaagagctatttctggcacaggttctattcgcaccagcccgacctcaattac
gacaacccccgggtgcacgaggcgatgttccgggtcatcgacttctggctcgggatgggg
gtggacggcctgaggctcgacgcggttccctacctctacgagcgggaggggaccaactgc
gagaacctcccggagacctacgagttcctgaagaagctgcgcgcctacatcgacgcgaag
tatccggaccggatgctcctggccgaggccaaccagtggccggaggacgccgcctcctac
ttcggggggggagccgcctgccagatgtgcttccatttcccgctcatgccccgcatgttc
atggcgctgcagatggaggattccttccccatcatcaacatcctgcagcagaccccggtc
atcccgcagcagtgccagtgggcgctgtttcttagaaaccacgacgagctcaccctggag
atggtgaccgacgaggagcgggactacatgtaccggatctacgcccgggaccccagggcg
cgcatcaaccttgggatccggcgccggctggcgccgctcatgggggacgaccggcgcaag
atcgagctgatgaacgtccttcttttctgcctacccggcacccccatcatctactacggc
gacgagatcggcatgggggacaactattacctgggcgaccgcaacggcgtgcgcacgccg
atgcagtggagccccgaccgaaacgccggcttctccccggtgaacccgcaaaagctctac
ctccccgccatcatcgatccggagtaccactacgaggcgcgtaacgtcgagaaccaggcg
aagaacccctcttcgcttctttggtggatgaagcggatgatcgatctgaggaagcggttc
aaggccttcggctgggggagcgtcgagttcatgccgctggagaactcaaaggtgctggcc
atggtcaggaagtacgaggaccaggccatcctggtgctgatcaacctctcccgcgccacg
cagttcgtgcaggtgaaccagccgcgtttcgtcggcttttatcccgaggagatgttcagc
cgcaaccggttcccggtgatcaaggactccccctacggcgtcatcctgggagcttacgac
taccaccttctgctgatgaaggacggaagcgaagaggtgaagccccgggaggagggggtg
ctggaggaggtcccggtcaccggcagctgggagaacgtgttgaggtcggcggggctcagg
cagctggaacagtcggtgcttccggaatacctgaagaggtcccgctggttccaggggaag
agccggatcatggttcgcttctcggtgatggagaagattcccgtcccggtcaacagctct
tcggtgatcctcacgcttttggaggtgagctacagcgagggggcgcctgagacctacctg
ctgccgcttcacttcgtccccatggacggcggaggcgagggtattctcaccgagacgccg
gccgccgtcgtctgcaagctgcgcatcggcgacaaggtcgggatcctctacgacggcacc
tacaactcccatttccgctgggcgctcttcgagatgatctggcgccgcaaggcgatccgc
accgacggggggaggttctccgggcgcccggccagcggcatgggggcgctcatggaaggg
aaggagcctccgttcgtctcccaggtggggaagtcggaacaaagcaacacctcgatgctc
ttcgacaagcacttcttcctgaagctgtaccggcggctggaagagggggcgcatccggaa
gtcgagatcgggaggttcctctcggaccggatccgtttccagcacgtggcgcccctggcc
gggaccatcgagtaccggcgacccggcctggaaccggtggccatcgggatgctgcaggcc
ttcgtccccaaccagggggacgcctgggcctttaccctcggtgaagcggggcagttcgtc
gatcgcgtgctggcccatcgcgaggaggcaaaggaatccgggactcccgccgtctcccag
ccggacaccgcggccaccggcttctccacggtgctgcatgacctgatccaggggttgtac
ccggagatggtgaccctgatcggaaagcgcacggcggagctgcatttggctctttcctcc
cgcagcgacgacccctccttcgcgcccgaaccctttgcgcttctttaccagcgctcggtg
taccagtcgatgcgcagccgcaccaggaaggccttcgacctcttgcgccggaacctgggc
cggcttccccaggaactggtgcaggaggccgaggcgctcctggggatggagccggaagtg
cagggcgccctgcagaagttcacgatcagcaagttttcggcgatgaagacgcgggtccac
ggcgactaccacctggggcagctactctacaccggcgacgatttcctgatcatggacttc
gaaggggaaccggtgaaatccctgggagagcgaaggatcaagcagtcgccgctcagggac
gtggcggcgatgatgcgctccttcgagtacgcgggtcacgccgtactgatgcagaggacc
caggtccgggaagaggacgtcgccttcctgctcccttggatccaggcttggtgccgctac
aactcctcccttttcctcgcctcctaccaaaagaaggtggaagggtgcaatttcatgccg
gacaacccgcaggatgtggagaccatgctgcgctgcttcatgttggacaaggcggtctat
gaactggggtacgaactgaacaaccgcccggactgggtctccataccgctgcgcggcatt
atgaacctgctggcgtcggaaaagagcgttccgaagctggaggggcaatga

DBGET integrated database retrieval system