KEGG   Geobacter sp. M21: GM21_0511Help
Entry
GM21_0511         CDS       T00933                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
gem  Geobacter sp. M21
Pathway
gem00473  D-Alanine metabolism
gem00550  Peptidoglycan biosynthesis
gem01100  Metabolic pathways
gem01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gem00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GM21_0511
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GM21_0511
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    GM21_0511
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gem01011]
    GM21_0511
Enzymes [BR:gem01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     GM21_0511
Peptidoglycan biosynthesis and degradation proteins [BR:gem01011]
 Precursor biosynthesis
  Amino acid ligase
   GM21_0511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 GARS_A ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ACT16591
UniProt: C6DZK9
LinkDB All DBs
Position
628616..629533
Genome map
AA seq 305 aa AA seqDB search
MTVEELKKKKIAVLMGGLSAEREVSLNSGKAVLASLVRQGFQAVGIDVGRDLPQRLAEEK
AEVAFIALHGRFGEDGSVQGLLELMGIPYTGSGVLASALAIDKIASKVIFASAGLTLAPY
QVLRRGEEFKLANPLPVVVKPSREGSSVGVGIVRDPSRMQAALDEAFRYDSEILIEGFID
GREVQVGILDGKALGAIEIVPKGEFYDYEAKYTDGGAQHILPARLPEAVYGEVLRQGEKA
HAALGCDCYSRVDFLVTETGDCFLLEVNTLPGMTDLSLLPEIAGGAGITFGELVLRILQA
ASLKI
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgacggtagaggagctgaaaaagaagaagatcgcggtgctgatgggtgggctttccgcc
gagcgcgaggtgtccctcaacagcggcaaggcggtccttgcctccctggtcaggcagggg
ttccaggccgtcggtatcgacgtcggtcgcgacctgccgcagcggctggccgaggaaaag
gcggaagtcgccttcatcgcgctgcacggccgcttcggcgaggacggctcggttcaggga
ctgttggagctgatgggcatcccctataccggctccggggtgctcgccagcgcgctcgcc
atcgacaagatcgcctccaaggtgatcttcgcgtcggcggggttgacgctcgccccctac
caggtgctgcgccggggcgaggagttcaagctcgccaacccgctcccggtcgtggtgaag
ccttcccgtgaaggctcctccgtcggagtcggcatcgtgcgcgacccctcccggatgcag
gcggcgctcgacgaggcgttccgctacgactccgagatcctcatcgaagggttcatcgac
ggccgcgaggtccaggtcggcatactggacggcaaggcgctcggcgccatcgagatcgtc
cccaagggggagttctacgactacgaggcgaagtacaccgacggcggcgcgcagcatatc
ctcccggcgcgcctccccgaggcggtctacggcgaggtgctgcggcagggggagaaggcg
cacgcggcgcttgggtgcgactgctacagcagggtcgacttcctggtcaccgagacgggc
gactgcttcctcctcgaggtgaacaccctcccggggatgacggacttaagcctgcttccc
gaaatagctgggggagccggaattaccttcggcgaattggtactgcgcatactgcaggcg
gcttcgctgaagatctag

DBGET integrated database retrieval system