KEGG   Geobacter sp. M21: GM21_1396Help
Entry
GM21_1396         CDS       T00933                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
gem  Geobacter sp. M21
Pathway
gem00061  Fatty acid biosynthesis
gem00780  Biotin metabolism
gem01100  Metabolic pathways
gem01130  Biosynthesis of antibiotics
gem01212  Fatty acid metabolism
Module
gem_M00083  Fatty acid biosynthesis, elongation
gem_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:gem00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GM21_1396
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    GM21_1396
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    GM21_1396
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gem01004]
    GM21_1396
Enzymes [BR:gem01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     GM21_1396
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     GM21_1396
Lipid biosynthesis proteins [BR:gem01004]
 Fatty acid synthase
  Component type
   GM21_1396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ACT17455
UniProt: C6E4F7
LinkDB All DBs
Position
complement(1645833..1646603)
Genome map
AA seq 256 aa AA seqDB search
MGLLEGKKALIFGVANDKSIAWAVAEAFRREGAEIALAYAGESVAKRVIPLGESIGASMI
LPCDVRSDEDIARLFSDVSKQWGGLDLLVHSVAFANKDELKGSFLNTTREGFATALDISA
YSLIALAKEAAPFMQGREGSIIAMTYYGAQKVFPNYNVMGVAKAALEASVRYLAEAMGPE
GTRVNAISAGPLRTLASAGIGGFGQIAGHVAGKAPLRRNITQEDVANSALYLASPLAGGV
TGEIHFVDSGYNIIGL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgggtttacttgaaggtaaaaaggcactgattttcggtgtcgccaacgacaaaagcatc
gcctgggcggtagccgaggcattcagacgcgagggggccgagatcgccctggcctacgcc
ggagagagcgtggccaaaagggtaatccccttgggcgagagcatcggggcgagcatgatc
ctcccctgcgacgtgagaagcgacgaggacatcgcccgtctcttctccgacgtctcgaaa
cagtggggggggctggacctcctggtgcactcggtagcgttcgccaacaaggatgagctc
aaggggtcgtttctgaacaccacgcgcgaagggttcgccacggcactcgacatcagcgcc
tattccctcatcgcacttgccaaggaggccgcgccgttcatgcaggggcgcgagggaagc
atcatcgccatgacctactacggcgcgcagaaggttttccccaactacaacgtgatgggg
gtcgccaaggccgcgcttgaggcaagcgtgcgctacctcgccgaggccatgggccccgaa
gggacccgcgtcaacgccatctccgcgggccccctgcgcaccctcgcctcggcgggcatc
ggcggcttcggccagattgcaggccacgtcgccggcaaggcgccgcttagacgcaacatc
acccaggaagacgtcgccaactcggcgctctacctcgccagcccgctcgccggcggggtg
accggcgagatccacttcgtcgacagcggctacaacatcatcggcctgtaa

DBGET integrated database retrieval system