KEGG   Geobacter sp. M21: GM21_3330Help
Entry
GM21_3330         CDS       T00933                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
gem  Geobacter sp. M21
Brite
Translation factors [BR:gem03012]
 Eukaryotic Type
  Elongation factors
   GM21_3330
 Prokaryotic Type
   GM21_3330
Mitochondrial biogenesis [BR:gem03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    GM21_3330
Exosome [BR:gem04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GM21_3330
  Exosomal proteins of breast cancer cells
   GM21_3330
  Exosomal proteins of colorectal cancer cells
   GM21_3330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW AAA_29
Motif
Other DBs
NCBI-ProteinID: ACT19355
UniProt: C6E4Q9
LinkDB All DBs
Position
complement(3852008..3853198)
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLAGKGQAEFKAFDQIDNAPEERERG
ITIATAHVEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVFLNKADMVDDEELLELVELEVRELLSSYDFPGDDIPIIKGSALKGLE
GDAGELGEQAIMKLMEAVDTYIPEPVRAIDKPFLMPVEDVFSISGRGTVATGRVERGIVK
VGEEVEIVGMKATAKTTVTGVEMFRKLLDEGRAGDNIGALLRGVKREEIERGQVLSKPGS
ITPHTKFKAEAYILSKEEGGRHTPFFNGYRPQFYFRTTDVTGVVDLEAGVEMVMPGDNVS
VTVNLITPIAMDEGLRFAIREGGRTVGAGVVASIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagctaaatttgaaagaaccaagccgcacgttaacatcggcaccatcggccac
gtcgaccacggcaagaccaccctgaccgcagcgatcaccaaggtcctcgcaggcaagggc
caggccgagttcaaggcgttcgaccagatcgacaacgcaccggaagagcgcgagcgcggt
atcaccatcgcgaccgcacacgtagagtacgagaccgacaagcgtcactacgcccacgtc
gactgccccggccacgccgactacgtaaagaacatgatcaccggcgcggcgcagatggac
ggcgcgattctggttgtttccgcagccgacggcccgatgccgcagacccgcgagcacatc
ctgctcgcacgtcaggtcggcgtcccctacatcgtcgtgttcctgaacaaggccgacatg
gtggacgacgaggaactcctcgagctggtcgagctggaagttcgcgaactcctctcctcc
tacgacttcccgggcgacgatatcccgatcatcaagggttccgctcttaaaggcctcgaa
ggcgacgccggcgagctgggcgagcaggccatcatgaaactgatggaagctgtcgacacc
tacatcccggagccggttcgcgccatcgacaagccgttcctgatgccggtcgaagacgtt
ttctccatctccggtcgcggtaccgtcgcaaccggtcgtgtcgagcgcggcatcgtgaag
gtcggcgaggaggtcgagatcgtcggcatgaaggccaccgcgaagaccaccgtcaccggc
gtcgagatgttccgtaagctcctcgacgaaggtcgcgcaggcgataacatcggcgcgctg
ctgcgcggcgtgaagcgggaagagatcgagcgcggccaggttctctccaagcccggctcc
atcaccccgcacaccaagttcaaggcagaagcctacatcctctccaaagaggaaggcggc
cgtcacaccccgttcttcaacggctaccgtccgcagttctacttcaggaccaccgacgtg
accggcgtggtcgacctcgaggcaggcgtcgagatggttatgccgggcgacaacgtctcg
gtgaccgtcaacctgatcaccccgatcgccatggacgaaggtctgcgcttcgcgattcgt
gaaggcggccgtaccgtcggcgccggtgtcgtagcctccatcatcgaataa

DBGET integrated database retrieval system