KEGG   Geobacter sp. M21: GM21_3904Help
Entry
GM21_3904         CDS       T00933                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
gem  Geobacter sp. M21
Pathway
gem00500  Starch and sucrose metabolism
gem01100  Metabolic pathways
gem01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GM21_3904
Enzymes [BR:gem01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     GM21_3904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417 Capsule_synth
Motif
Other DBs
NCBI-ProteinID: ACT19921
UniProt: C6E8D0
LinkDB All DBs
Position
4490646..4493198
Genome map
AA seq 850 aa AA seqDB search
MNLSSTLHRFTVVPSLPKELAGLQRIAYNLWWSWEPEAIGLFKRLDPELWRLTRHNPLEV
LGSLQQATFESLMADEGFMSHLSQVEERLTEYLSSRTWYERHGNPGARIAYFSMEFGLHE
SLPIYSGGLGILAGDHLKSASDLGLPLVGVGLLYRQGYFRQYLNLEGWQQEIYPENDFYN
LPLHQERDREGKPLAFSLEYPGRNVRVQVWRVQVGRVNLYLLDTNLEENSPADREITTRL
YGGDQEMRIRQEILLGIGGVRALRLLGAEPNVCHMNEGHAAFLALERIRSLMEQRQLNFR
EAMEAVRGGNVFTTHTPVEAGIDHFPPDLLDQYMGHYYRSLGLSREQFMALGMQNHGRSN
ESFCMAVLAMKLSLHSNGVSELHGEVSRRMWADVWPDLPEEQLPLTYVTNGVHQKSWLSE
EMTGLLIRFLGTRWLEQSADQLWRRVSRIPDAELWRTHRRGTEQLVDYARRSLRAQLEKL
DASAKEIDAAGDVLDPEILTIGFARRFATYKRGTLLLHDKERLFRILNHPERPVQIVFAG
KAHPADHQGKELIRQIVQLSQQPEFRRRIVFLEDYDISVARRLVQGVDVWLNTPLRPLEA
SGTSGMKVAFNGGLNLSILDGWWCEGYRGNNGWAIGRGEVYDDLAYQNQVESRAIYDLLE
KEIVPLFYNRGSDGIPRGWTAFMKSSMQTLCPVFSTDRMVQEYARRCYLPAFEHWERLNR
DNLRLAVELARWKERLHGMWGELSIVAVHAEIRKEVTVGEMLPITVQITPGRIPLSEIAV
EVYFGVLDSRGAIIGGEIVPLEPAADPEKAGHFGGELECRFCGRHGFMLRVMPRHPELGT
VYDPGLILWG
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgagctcaacgctgcacagatttaccgtcgtcccctcgcttcccaaagagctt
gctgggctgcagcgcatcgcctacaacctctggtggagctgggaacccgaggccatcggc
cttttcaaacggctggaccccgaactctggcgcctgacgcgccacaaccccctcgaggtg
ctgggaagcctgcagcaggcgaccttcgagagcctgatggcggacgaggggttcatgtcc
cacctctcgcaggtagaggagcggctcaccgaatacctctcctcccgcacctggtacgag
cggcacggcaaccccggcgcccgcatcgcctacttctccatggaattcggcctgcacgag
tcgctccccatctactccggggggctcggcatcctcgcgggcgaccacctcaaatccgcc
agcgatttaggactccccctggtcggcgtcgggcttttgtaccgtcaggggtacttccgc
cagtacctgaacctggaagggtggcagcaggaaatctacccggaaaacgacttctacaac
ctcccgctgcaccaggagagggacagggaaggaaagcccctggcgttctccctggagtac
ccggggaggaatgtgcgggtgcaggtctggcgggtgcaggtagggcgggtcaacctctac
ctcctggacacgaacctcgaggagaattcccccgccgaccgcgagatcaccaccaggctc
tacggcggcgaccaggagatgcggatcaggcaggagatcctgctcggcatcggcggcgtc
cgggcgctgaggcttttgggggccgagcccaacgtctgccacatgaacgaggggcacgcc
gccttcctggcgctggagcggatccgctccctgatggagcagcgccagctcaacttccgg
gaggcgatggaggcggtgagaggcggcaacgtcttcaccacccacacgccggtcgaggcc
gggatcgaccatttcccacccgacctcctcgaccagtacatgggtcattactaccgcagc
ctcgggctctcccgcgagcagttcatggccctggggatgcagaaccacggcaggagcaac
gaaagtttctgcatggcggtgctcgccatgaagctctcgctccactcgaacggggtgagc
gaactgcacggggaggtgtcgcgcaggatgtgggcggacgtctggccggacctccccgag
gaacagctcccccttacctacgtcaccaacggggtgcaccagaagagctggctctcggag
gagatgaccggcctgttgatccggttcctcggcaccagatggctggagcaaagcgccgac
cagctctggcgcagggtctcgcgcatcccggacgcggaactttggcgcacgcaccggcgc
ggcaccgagcagctggtcgactacgcgcgccgcagcctgagggcgcagttggagaagctc
gacgcctccgccaaggagatcgacgcggcaggcgacgtcctcgacccggagatactcacc
atcggcttcgcgcgccgcttcgccacctacaagcgagggacgctcctgttgcacgacaag
gagcggcttttcaggatactgaaccatcccgagcggccggtgcagatcgtcttcgccggg
aaggcgcaccccgccgaccaccagggtaaggagctgatccgccagatcgtgcagctgtcg
cagcagcccgaattccggcgccgcatcgtcttcctggaggattacgacatctcggtggcc
cggcgcctggtgcagggggtggacgtctggctcaacacgccgctcaggcccctggaggcc
agcggcaccagcggcatgaaggtcgccttcaacggcggcctcaacctgagcatcctggac
gggtggtggtgcgaggggtaccgcgggaacaacggctgggccatagggcgcggcgaggtg
tacgacgacctggcctaccagaaccaggtggagagccgcgccatctatgaccttctggag
aaggagatcgtgccccttttctacaaccgggggagcgacggcatcccgcgcggctggacc
gccttcatgaagagctcgatgcagacgctctgcccggtgttcagcacggaccggatggtg
caggagtacgccaggcgctgctaccttcccgccttcgagcactgggagcggctgaaccgc
gacaacctgaggctcgcggtggagctggcgcgctggaaggagcggctgcacggcatgtgg
ggtgagctttccatcgtggcggtccacgccgagatccggaaggaagtgacggtgggggag
atgctccccatcacggtgcagatcacgccgggacggatccccctttcggagatcgcggtc
gaggtatatttcggagtgctcgattcccgcggcgccatcatcgggggggagatcgtgccg
cttgagcctgcggccgacccggaaaaggcggggcacttcggcggggaactggagtgccgc
ttctgcggcaggcacggcttcatgctgcgggtaatgcccaggcaccctgagcttgggacc
gtgtacgatccggggttgatactctggggctga

DBGET integrated database retrieval system