KEGG   Geminocystis sp. NIES-3709: GM3709_1338Help
Entry
GM3709_1338       CDS       T04142                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gen  Geminocystis sp. NIES-3709
Pathway
gen00010  Glycolysis / Gluconeogenesis
gen00020  Citrate cycle (TCA cycle)
gen00620  Pyruvate metabolism
gen01100  Metabolic pathways
gen01110  Biosynthesis of secondary metabolites
gen01120  Microbial metabolism in diverse environments
gen01130  Biosynthesis of antibiotics
gen01200  Carbon metabolism
Module
gen_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GM3709_1338
   00020 Citrate cycle (TCA cycle)
    GM3709_1338
   00620 Pyruvate metabolism
    GM3709_1338
Enzymes [BR:gen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GM3709_1338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl AATase Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: BAQ64573
UniProt: A0A0D6ANY7
LinkDB All DBs
Position
1508403..1509635
Genome map
AA seq 410 aa AA seqDB search
MTEGKIVSWEKAPGDRIEKGETVVVVESDKADMDVESFYSGYLATILVQAGEEAPVGQAI
AYIAETEAEIETAKQKASQGQTVTTPAPTPEVKPIVEPQPIGVTTTVATPAKSNGRIIVS
PRAKKLAKELKVDLSNIIGTGPNGRIIAEDVEKAVGKTPQMPPVVPVSIPTKVQPTITPT
PVVNNLAGETVPFNTLQQAVIRNMMASLQVPTFQVSYTITTDALDTLYRKIKSKGVTMTA
LLAKAVAMTLQKHPVVNAGFTDKGIKYNEGINIAVAVAMPDGGLITPVIKNADQLDIYSL
ARNWQDLVNRARAKQLQPDEYTTGTFTLSNLGMFGVNDFTAILPPGTGAILAIGGVRPTV
VANKDGLFGVKNQMTVNITCDHRTIYGADAAGFLQDLAKLIENDSHSLTL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgactgaggggaaaattgtttcatgggagaaagcacccggagatagaattgaaaaagga
gaaaccgttgttgtcgtggagtcagacaaagcggatatggatgtagaatccttctattct
ggttatttagccactattttagtacaagcaggagaagaagcccccgttggtcaggcgatc
gcttacattgcagagacagaagcagaaatcgaaacagcaaaacaaaaagctagtcaaggg
caaaccgttaccactcccgcaccaactccagaagtaaaacccatagttgaacctcaacca
ataggagtaaccaccaccgtagcaacccctgcaaaaagtaacggtagaataattgtctct
cctagagcgaaaaaactagcaaaagaattaaaagtcgatttaagtaatattatcggtact
ggacctaatgggcgtattattgcggaagatgtggaaaaagccgttggcaaaacgcctcaa
atgccacctgttgtccctgtcagtattcctacaaaggttcaacccactattacccctact
cctgttgttaataatttagcaggagaaacagttcctttcaacactttacaacaagccgtt
attcgcaacatgatggctagtttacaagtacccactttccaagttagctacactatcacc
acagatgcgttagatactctttatcgcaaaattaaatcaaaaggtgtcactatgacggca
ttacttgccaaagcagtggcgatgacgttacaaaaacatcccgtcgttaacgcaggtttt
acggataaaggtattaaatataacgaaggtataaatattgccgtagcggtggctatgcct
gatggtggtttaattactcctgttattaaaaatgctgatcaattagatatttactcctta
gcgcgtaactggcaagacttggttaatcgagcgcgtgccaaacaattacaacccgatgaa
tataccacaggtacatttaccctttctaatttaggaatgtttggagtaaatgactttacc
gctattttacctcccggcactggggctattttggcgatcggtggtgtccgtcctacagtt
gtagctaataaagacggtttatttggtgtaaaaaatcaaatgactgtcaatataacttgt
gatcatcgtactatttatggtgcagatgcggcaggatttttacaggatttagcaaaatta
atcgaaaacgatagtcattctctaactctttag

DBGET integrated database retrieval system