KEGG   Geminocystis sp. NIES-3709: GM3709_1939Help
Entry
GM3709_1939       CDS       T04142                                 

Definition
(GenBank) ribose 5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
gen  Geminocystis sp. NIES-3709
Pathway
gen00030  Pentose phosphate pathway
gen00710  Carbon fixation in photosynthetic organisms
gen01100  Metabolic pathways
gen01110  Biosynthesis of secondary metabolites
gen01120  Microbial metabolism in diverse environments
gen01130  Biosynthesis of antibiotics
gen01200  Carbon metabolism
gen01230  Biosynthesis of amino acids
Module
gen_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
gen_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
gen_M00165  Reductive pentose phosphate cycle (Calvin cycle)
gen_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
gen_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:gen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GM3709_1939
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    GM3709_1939
Enzymes [BR:gen01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     GM3709_1939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC Sugar-bind
Motif
Other DBs
NCBI-ProteinID: BAQ65174
UniProt: A0A0D6ARZ7
LinkDB All DBs
Position
complement(2188488..2189168)
Genome map
AA seq 226 aa AA seqDB search
MKQEVGKIAASKVKSNTIVGLGTGSTTAYAIQYIGERLANGELTNIVGVPTSFQAEVLAK
KYGIPLTTLDAIDHIDVAIDGADEVDPHKNLIKGGGAAHTREKVVDSLADQFIVVVDGGK
LVDELGSTFLLPVEVIPMAVTPVMRQLEELGGKPELRMGIKKAGPVVTDQGNLVIDVKFD
RIDNPAELEMKINNLPGVLENGLFVGVADVILVGEIIDGKPSVREF
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagaagtgggtaaaatagctgcttctaaggtaaaatcaaacacgatcgtagga
ttgggtacaggttcaactacggcttatgctattcaatacatcggcgaaagactagctaat
ggtgagttaaccaatattgtaggtgttccaacttcatttcaagctgaagttttagcaaaa
aaatatggtattcctcttaccactttggatgcgatcgatcatatagatgtcgcaattgat
ggtgcagatgaagttgatcctcataaaaacttgattaaaggcggtggtgcagcccatact
agagaaaaagtagttgacagtttagcggatcaatttatagtagtggtagatggtggtaaa
ttggtagatgagttaggttctacttttttattaccagtagaagtaattcctatggctgta
actccggtaatgcgtcaattggaagagttagggggtaagccagagttaagaatgggtatc
aaaaaagctggccctgtggtaacagatcaaggtaatcttgttattgacgtaaaattcgat
cgtattgataatcctgcggagttagaaatgaaaattaataaccttccgggggtattagaa
aatggcttatttgtaggagtagctgacgtgatattggtaggagaaataattgatggcaaa
ccctcagtaagagaattttaa

DBGET integrated database retrieval system