KEGG   Geminocystis sp. NIES-3709: GM3709_3181Help
Entry
GM3709_3181       CDS       T04142                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
gen  Geminocystis sp. NIES-3709
Pathway
gen00473  D-Alanine metabolism
gen00550  Peptidoglycan biosynthesis
gen01100  Metabolic pathways
gen01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gen00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GM3709_3181
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GM3709_3181
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    GM3709_3181
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gen01011]
    GM3709_3181
Enzymes [BR:gen01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     GM3709_3181
Peptidoglycan biosynthesis and degradation proteins [BR:gen01011]
 Precursor biosynthesis
  Amino acid ligase
   GM3709_3181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 DUF2148 Methyltransf_3
Motif
Other DBs
NCBI-ProteinID: BAQ66416
UniProt: A0A0D6AUJ9
LinkDB All DBs
Position
3579773..3580822
Genome map
AA seq 349 aa AA seqDB search
MGKLRVGLLFGGKSGEHQVSIISARSILKGLTSESNSSKYDVIPIYIDKSGYWRSSDIAR
EILASGIPIDNDSTTTSLWNFPPECNNIDVWFPILHGPNGEDGTVQGLLTLMQVPFVGSG
VLGSAVGMDKIAMKNIFAQEGLPQVKYIGINRDEIYSGACIFPKLCDKIEEELGYPCFVK
PANLGSSVGIAKAKTRSELESALDNAASLDRRVIVEAGVKAREVECAVLGNDNPKASVIG
EITYNADFYDYETKYTDGRANLIIPADIPPHIVTKIQEMSIEAFRAVSARGLSRVDFFYI
TDTEEIFINEINTLPGFTSLSMYPQLWEASGIPFSELVDKLITLAISNS
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagttaagggtaggattgttatttggaggaaaatcgggagaacatcaagtctct
attatatcggcacgatcgatcctaaaagggttaacctcagaaagtaatagtagcaaatat
gatgtaatacccatttatattgataaatcgggctattggcgcagtagtgacattgccaga
gaaattcttgccagtggtattccaatcgataatgattctaccacaacttccttatggaat
tttcctcctgaatgtaataatatcgatgtgtggtttcctattctacatggacccaatggt
gaagatggtacagtacaaggattattaactttaatgcaagtgccttttgtgggttctggt
gtattaggctcggcagtagggatggataaaatcgccatgaaaaatatttttgcccaagaa
ggattaccccaagttaagtatattggtattaatcgtgatgagatttatagtggtgcttgt
atctttccgaagttgtgtgacaaaattgaagaggagttgggctatccttgttttgtgaaa
cctgctaatctgggatcatccgtgggtattgctaaagcaaaaactcgatcggaattagaa
agtgctttagataatgcggctagtctcgatcgacgtgttattgtggaagcaggagttaaa
gccagagaagttgagtgtgctgttttaggtaacgacaatcccaaagcctctgttatcgga
gagataacctataatgcagatttttatgactacgaaactaaatatactgatggtagggcg
aatttaattattcctgcggatattcccccccatattgtaactaaaattcaagaaatgtcg
atcgaagcattccgtgcagtatcagcccgaggattatcaagggttgactttttctacatt
actgacactgaagaaatttttatcaacgaaattaacactcttcccggtttcacctcttta
agtatgtatccccaattatgggaagcatctggtattcctttttcagaattagtagataaa
ttaatcactttagccataagtaattcataa

DBGET integrated database retrieval system