KEGG   Geminocystis sp. NIES-3709: GM3709_3302Help
Entry
GM3709_3302       CDS       T04142                                 

Definition
(GenBank) bicarbonate transport system permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
gen  Geminocystis sp. NIES-3709
Pathway
gen00910  Nitrogen metabolism
gen02010  ABC transporters
Module
gen_M00438  Nitrate/nitrite transport system
gen_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:gen00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    GM3709_3302
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    GM3709_3302
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gen02000]
    GM3709_3302
Transporters [BR:gen02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    GM3709_3302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: BAQ66537
UniProt: A0A0D6AUI7
LinkDB All DBs
Position
3698974..3699810
Genome map
AA seq 278 aa AA seqDB search
MTARLQKTSKDSNILNSILYSQNLRKVVAPLIALFVILAIWQILCSGEKPNLPSPITVIK
DTWDPYIINPFFHNGGTDVGLFWQLLASLKRVAIGFSLATVVGIALGILIGANRLVYQAL
DPIFQVLRTIPPLAWLPISLAALRQADPSAIFVIFITAIWPIIINTTVGVQQIPQDYNNV
SRVLKLTKIEYFFNILFPSTVPYIFTGLKIGIGLSWLAIIAAEMLVGGVGIGFFIWDAYN
SSEMSQIILALIYVGIIGLLLDRLVSFVATLVVPEEQK
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaagacttcaaaaaacctctaaagattccaatattttaaactctattctttat
tctcaaaatcttagaaaggttgttgctcctcttattgctttgtttgttatattggcaatt
tggcaaattttatgctcaggagaaaagcccaatttaccgtctccgattactgtcatcaaa
gatacttgggatccctatattatcaatccattttttcacaatggtggtacggatgttggg
ttattttggcaacttttagccagtttaaaaagagttgcgatcgggttttctttagccaca
gtagtgggcattgcattaggaattttaatcggtgcaaatcgcctagtttatcaggcttta
gatcctatttttcaggtattaagaacgattcctcctttagcttggttgcctatatcccta
gccgctttaagacaagctgatccttctgctattttcgttatttttattacagcaatctgg
cctattatcattaatacaacagtaggagttcaacaaattccccaagattataataacgtt
tctagggtgttaaaactgacaaaaattgagtacttttttaacatcttatttccttccaca
gttccctatattttcacaggtttaaaaattggtattggtttatcttggttagcaattatt
gccgctgaaatgttagtgggcggtgtgggtattggtttctttatttgggatgcttataat
agctccgaaatgagtcaaattattcttgctttaatctatgtaggaattatcggtttattg
ttagatagattagttagttttgttgctactttagttgtacctgaagaacaaaaataa

DBGET integrated database retrieval system