KEGG   Geminocystis sp. NIES-3709: GM3709_759Help
Entry
GM3709_759        CDS       T04142                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
gen  Geminocystis sp. NIES-3709
Brite
Enzymes [BR:gen01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GM3709_759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: BAQ63994
UniProt: A0A0D6ANH8
LinkDB All DBs
Position
complement(834436..835041)
Genome map
AA seq 201 aa AA seqDB search
MAYQLPTLPYEYTALEPCISKSTLEFHHDKHHAAYVTNFNKAVEGTELDSKSIEEVITIT
ATNPSQAGIFNNAAQAWNHSFYWQCMKPNGGGTPSGALADKIEADFGSFDKFVEAFKTAG
ATQFGSGWAWLVLDGGALKVTKTGNADNPFTAGQIPLLTMDVWEHAYYLDYQNKRPDYIS
DFLGKLVNWDFVADNFAKATA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcttatcaattaccaacacttccttacgaatatactgctttagagccttgtatctct
aaaagtaccttagagtttcatcacgacaaacatcatgcggcttatgttactaactttaac
aaagctgtggaaggtacggaattagactctaaatccattgaagaagtcatcaccattacg
gctactaatccaagtcaagcaggtatttttaataatgccgcccaagcatggaatcatagt
ttttattggcaatgtatgaaacccaatggaggtggaactcctagcggtgcattggcggac
aaaattgaggcagattttggaagttttgacaagtttgtggaagcatttaaaaccgcaggg
gcgactcaatttggtagcggttgggcatggttagtgttagacggtggtgctttaaaagtt
actaaaacgggtaatgctgataatccctttactgctggacaaattcctttgttaacaatg
gatgtatgggaacacgcttactatttagattatcaaaataagcgtcctgactatattagc
gattttctcggtaaattagttaactgggattttgtagctgacaattttgccaaagctacc
gcttaa

DBGET integrated database retrieval system