KEGG   Geobacter daltonii FRC-32: Geob_0532Help
Entry
Geob_0532         CDS       T00846                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
geo  Geobacter daltonii FRC-32
Pathway
geo00500  Starch and sucrose metabolism
geo01100  Metabolic pathways
geo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:geo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Geob_0532
Enzymes [BR:geo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Geob_0532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417 Capsule_synth
Motif
Other DBs
NCBI-ProteinID: ACM18899
UniProt: B9LZT5
LinkDB All DBs
Position
complement(602967..605531)
Genome map
AA seq 854 aa AA seqDB search
MNFSKILHRFTVTPSLPKELAGLQRIAYNLWWCWEPDAIELFTRLDPELWRETRHNPVEM
LGILQQTTLEMLKADEGFISHLAMVEDKLKEYLAAKTWYSKLHREDDGLRVAYFSMEFGL
HESLPIYSGGLGILAGDHLKSASDLGLPLVGVGLLYRQGYFRQYLNIEGWQQEFYPENDF
YNLPLHLERKADGTPLLLELDLAGNRVKIQIWRAQVGRIPLYLLDTNLEENSPDDRNITT
RLYGGDQEMRIRQEILLSIGGVRALHLLGIEPHVCHMNEGHAAFLSLERTRLLMEERRLK
FSEACEAVKAGTVFTTHTPVEAGIDHFPADLIDKYLGRYYRGLGLSREEFLSLGRQNARN
PHEMFCMAVLALKLTGHANGVSQLHGEVSRKMWKNVWPDLPEEHLPLTSITNGVHNKTWL
SREMARLLIRYLGTRWLEDPTDASVWRRVSRIPDGELWRTHKHGREHLVDYARKRLKEQL
CQVGATAKEIAVADEVLDPDILTIGFARRFATYKRGTLLLHDVERLARIVNNSTRPVQIV
FAGKAHPADHQGKELIRQIVQLSHQERFRHRIVFLEDYDMSVARHLVQGVDVWLNTPLRP
LEASGTSGMKVAFNGGLNMSVLDGWWCEGYRGNNGWAIGKGEVYDDLEYQNEVESRAIYD
LLEKEIVPLFYDRGSDGIPRGWIACMKASLQSLCPTFSTDRMVQQYSETFYFTAFEQWQM
LNENNSTLAVDLARWKEKMHRLWHHVRIEQVEAEMSQDILAGSSIPLRAKIFVDEIPLDQ
LAVDAYYGVLDSRGAIIGGELVPLTPSAPDGAGAHYFSGQLDCRFCGRHGFMLRVMPKHP
VLGPIYEPSLLLWG
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcagcaaaatccttcaccgttttaccgttactccctcgttaccaaaggaactg
gccggcctccagcgtatcgcctataacctgtggtggtgctgggaacctgatgccatcgag
cttttcacacgactcgatccggaactgtggcgggaaacccgtcacaatccggtggagatg
ctgggcatcctgcagcagacaaccctggaaatgctcaaggccgacgagggcttcatctcc
catctggccatggtggaagacaagctcaaggaatacctggcggcaaagacctggtacagc
aagctgcaccgggaggacgacggtctccgcgtcgcctacttctccatggagttcggcctg
cacgaatcactccccatatattctggggggctcggcattctcgccggcgatcatctcaaa
tcggccagcgacctggggctccccctggtgggggtcgggctcctctaccgccagggctat
ttccgccagtacctgaacatcgagggatggcagcaggaattttatccggaaaacgatttc
tacaacctgcccctgcaccttgaacgcaaggccgatggcacaccgctccttcttgagctg
gacctggcgggcaaccgggtaaagatccagatctggagggctcaggttgggcgcatcccc
ctttacctccttgataccaacctggaggaaaattccccggatgaccggaacatcaccacc
cgtctctacggcggcgatcaggaaatgcgcatcaggcaggagattctgctctccatcggc
ggcgtcagggcactgcaccttctggggatagaaccacatgtctgccacatgaatgaaggc
cacgccgcctttctctccctggagcggacccgcctgctcatggaggaacgccgcctcaaa
ttcagcgaggcctgcgaagcggtaaaggccggcactgtcttcaccacccacaccccggtg
gaagccggaatcgaccactttcccgctgacctgatcgataaatacctgggacgctactac
cgtggcctgggactgtccagggaagaatttctctccctcggacggcagaacgcccgcaat
ccccacgaaatgttctgtatggcagttctggccctgaaactcaccggtcacgccaacggc
gtcagccaactccatggcgaagtctcgcggaaaatgtggaaaaacgtctggccggatctc
cccgaagaacatctgccgcttacctccatcaccaacggcgtccataacaaaacctggctt
tcccgagagatggcccggctgctgatccgttatctgggcacccgctggctggaagacccc
accgacgcctcggtctggcgccgtgtttcgcgcatacccgacggcgagctctggcgtacc
cataaacatggtcgggagcatctggtggattacgcccgcaaaaggctcaaggaacagctc
tgccaggtgggtgccaccgccaaggaaatcgccgttgccgatgaagtcctcgatcccgat
attctcaccatcggctttgcccgccgcttcgccacctacaagcggggtacgctgctgctt
cacgacgtggaacggctggcgcgtatcgtcaacaattccacccggccggtgcagatcgtc
tttgccggcaaggcgcatcccgccgatcaccagggtaaggaactcatccggcagatcgtt
cagctttcccatcaggagcgcttccgccaccgcatcgtctttctggaggattatgacatg
tcggtggcccgccacctggtacagggggtggatgtctggcttaacaccccgctgcgtccc
ctggaggcgagcggcaccagcggcatgaaagtcgccttcaacggcggcctcaacatgagc
gttctcgatggctggtggtgtgaaggataccggggcaacaacggctgggccatcggcaag
ggagaagtctacgacgaccttgaatatcagaacgaggtggaaagcagagccatctacgat
ctgctggagaaggagatcgtgcccctcttctacgatcggggcagcgacggcattccccgt
ggctggatcgcttgcatgaaggcatcgctgcagtcgctctgccccaccttcagcaccgac
aggatggtgcagcagtacagtgaaaccttctactttaccgcttttgaacagtggcagatg
ctgaacgaaaacaactcgacgctggccgtggacctggcaaggtggaaggaaaagatgcac
cgcctctggcaccatgtgcgcatcgagcaggtggaggcggagatgagccaggatatcctg
gccgggagcagcattccgctgcgggcgaagattttcgtcgacgagattcccctggatcag
ctggcggtggatgcctattacggcgtcctcgattcccgcggcgccatcataggcggtgaa
ctggtgccgcttacaccctcggcaccggacggggccggcgcccactatttcagcggccag
ctggactgccgcttctgcggccggcacggcttcatgctgcgggtcatgcccaaacacccg
gtgttgggaccgatctatgagccgagtttgcttttgtggggataa

DBGET integrated database retrieval system