KEGG   Geobacter daltonii FRC-32: Geob_0783Help
Entry
Geob_0783         CDS       T00846                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
geo  Geobacter daltonii FRC-32
Pathway
geo00473  D-Alanine metabolism
geo00550  Peptidoglycan biosynthesis
geo01100  Metabolic pathways
geo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:geo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Geob_0783 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Geob_0783 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Geob_0783 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:geo01011]
    Geob_0783 (ddl)
Enzymes [BR:geo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Geob_0783 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:geo01011]
 Precursor biosynthesis
  Amino acid ligase
   Geob_0783 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATP-grasp GARS_A RimK ATPgrasp_Ter ATPgrasp_ST MMADHC
Motif
Other DBs
NCBI-ProteinID: ACM19145
UniProt: B9M175
LinkDB All DBs
Position
851349..852275
Genome map
AA seq 308 aa AA seqDB search
MTSSDNKKIGVLMGGFSAEREVSLKSGAAVLKALVGLGYNAVGIDVDRNVATKIVAEGIN
AAFIALHGRYGEDGAIQGLLELMAIPYTGSGVLASALAMNKIFAKQAFQAAGLTVAPYRV
VCRGEVFDAKTFTFPFPVVVKPSQEGSSVGVSIVRQESELEAAMQDAFKYDREILIEQFI
KGAEVQVGILEDKALGAIEIVPKKEFYDFEAKYSPGMAEHILPARLPADLYEKVLRAGEE
GHRALGCSGYSRVDFLVTTEGLCYILEVNTLPGMTDLSLLPEIARGSGIEFGELVERLIS
AATLKIAQ
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaccagttcagataacaaaaaaatcggcgtattgatgggaggattttcggcagagcgc
gaggtttccctgaagagcggcgcagccgtgttgaaagcgcttgtcgggctcggctacaat
gcagtaggcattgacgttgaccgcaacgtggcaactaagatcgtagcggaaggcattaat
gccgcctttatcgcgctccatggccgatatggtgaagatggcgctatacagggcctgctg
gaattgatggccatcccctataccggctccggtgttttggccagtgctctggccatgaac
aagatatttgccaaacaggccttccaggcagcagggctgaccgttgccccttaccgggtg
gtttgccggggcgaagtattcgatgccaaaacctttaccttcccgttcccggtggtggta
aagccatcccaggagggttcttcggtcggcgtcagcattgtcaggcaggaatcggaactt
gaggctgcaatgcaggatgccttcaaatacgaccgggaaatactcatcgagcagttcatc
aagggagccgaagtccaggtgggaatattggaagacaaggccctgggtgccattgagatt
gtgccgaaaaaggaattttacgactttgaagcaaaatactcaccgggtatggccgagcat
atcctgccggcaagacttcctgccgatttatatgaaaaggtactgcgcgcgggggaagaa
ggtcaccgtgccctgggctgcagcggatacagcagggtggacttcctggtaacaaccgag
gggctttgttacatccttgaggtcaacacattgcccggcatgaccgacctcagcctgctg
ccggagatagcccgcggttcgggaatagagttcggggagctggtggagaggctgatttct
gccgccacattaaaaatagcacaataa

DBGET integrated database retrieval system