KEGG   Geobacter daltonii FRC-32: Geob_1151Help
Entry
Geob_1151         CDS       T00846                                 

Definition
(GenBank) pyridoxal-5'-phosphate-dependent decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
geo  Geobacter daltonii FRC-32
Pathway
geo00250  Alanine, aspartate and glutamate metabolism
geo00410  beta-Alanine metabolism
geo00430  Taurine and hypotaurine metabolism
geo00650  Butanoate metabolism
geo01100  Metabolic pathways
geo01110  Biosynthesis of secondary metabolites
geo01120  Microbial metabolism in diverse environments
geo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:geo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Geob_1151
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Geob_1151
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Geob_1151
   00430 Taurine and hypotaurine metabolism
    Geob_1151
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Geob_1151
Enzymes [BR:geo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Geob_1151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ACM19511
UniProt: B9M3A1
LinkDB All DBs
Position
1262779..1264449
Genome map
AA seq 556 aa AA seqDB search
MLKNREAARANLENLYRIFTVPEAPDSTLGAIDQAIAADVTGFLQTHIVAIERDLEAIEA
DFASAIIPEEPTYVSEYTEFVKENLVAQSVHTAAPGFVGHMTSAIPYFMLPLARLMTALN
QNLVKVETSKAFTPMERQVLAMLHHLVYRRDADFYPAWIHNSQHALGAFCSGGTIANVTA
LWVARNRLFAPSADFGGLAQEGLGRALQHRGAEGIAVLVSERGHYSFGKAADLLGLGRDN
LIKVQTDAHNRVDLKLLREEVRRLQDRNILPLALVGIAGTTETGNVDPLEALADLAGELG
CHFHVDAAWGGPTLFSDRFRSLLSGIERADSVTIDAHKQLYVPMGAGMVVFKDPTALSAI
EHHANYILRHGSKDLGSHTLEGSRPGMAMLVHAGLSIIGRKGYELLMDMGIERARTFAAM
IRQYPDFELTSEPELNILTYRYCPLNVQKALAAAPAEQRAGINALLDQVCQLLQKHQREA
GKTFVSRTRLRVARHDEELTVLRVVLANPLTTDEILAAVLAEQCEIVQQPEIQGLLQQVE
EICTGLTAKAADQSPN
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaaatcgtgaagcagctcgtgccaatctggaaaatctttaccggatctttacc
gtcccggaagcgcccgattcgaccctaggcgctatcgatcaggcgattgccgcagatgtc
accggctttttgcagacccatatcgttgccatcgaacgcgacctcgaagctatcgaggcc
gatttcgcctctgccatcatcccggaagaaccgacctacgtctccgaatataccgaattc
gtcaaggagaacctggtcgcccagtcggtccatactgctgcccccggctttgtcggccac
atgacttcggcgatcccctacttcatgctccccctggcgcgcctcatgacagccctcaac
cagaacctggtcaaggtggagacatccaaggcctttacccccatggagcggcaggtcctg
gccatgctccatcacctggtctaccgccgggatgccgacttctatcccgcctggattcac
aacagccagcatgccctgggggccttctgttccggcggcaccattgccaacgtcacggca
ctctgggtggctcgcaaccgtctcttcgctccaagcgctgattttggcgggcttgcacag
gaagggctgggccgggcgctgcagcatcgaggggctgagggtattgcggtcctcgtctcc
gagcgcggccactattccttcggcaaggccgccgatctcctgggcctgggccgggacaac
ctgatcaaggtgcagaccgatgcccataaccgtgtcgacctgaagctgttgcgggaagag
gtccggcgcctgcaggacaggaacatacttccgctggcattggttggcatcgccggcacc
accgaaaccggcaatgtcgacccgctggaggccttggctgatctcgcaggggagctcggg
tgccatttccatgtggacgctgcctggggtgggccgactctcttttccgaccggttccgc
tctctgctcagtggcatagagcgggccgactcggtcaccatcgatgcgcacaagcagctt
tatgttcccatgggggcggggatggtcgtcttcaaggatccgacggccctttcggcgatc
gaacatcacgcaaattacatcctgcgtcatggctccaaggatctgggaagccataccctc
gaaggatcacggccgggtatggcgatgttggttcatgccggtttatccatcattggccgc
aaggggtacgaactcctcatggatatggggatcgagcgggcgcggacctttgccgccatg
atccgccagtatcccgattttgaactgaccagcgaaccggagctgaatatccttacctac
cgctactgtccgctcaatgtacaaaaggccctggccgcagcgcctgctgagcaacgtgcc
ggtatcaatgcgctcctcgaccaggtctgccagctgctgcaaaaacatcaacgggaagcg
gggaaaacctttgtctcccgaacacggctgcgagtggctcgccatgatgaagaactaact
gtcctgcgcgtcgtgttggccaacccactgacgaccgacgagatcctggcggcggttctg
gccgagcagtgcgagatcgtgcagcagccggagattcagggcttgttgcagcaggtcgag
gaaatctgtacaggtctgactgcaaaggcggccgatcagtcgcctaattga

DBGET integrated database retrieval system