KEGG   Geobacter daltonii FRC-32: Geob_1202Help
Entry
Geob_1202         CDS       T00846                                 

Definition
(GenBank) membrane transglycosylase and transpeptidase PBP1A
  KO
K21464  penicillin-binding protein 2D [EC:2.4.1.129 3.4.16.4]
Organism
geo  Geobacter daltonii FRC-32
Pathway
geo00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:geo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Geob_1202
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:geo01003]
    Geob_1202
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:geo01011]
    Geob_1202
Enzymes [BR:geo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Geob_1202
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Geob_1202
Glycosyltransferases [BR:geo01003]
 Polysaccharide
  Bacterial polysaccharide
   Geob_1202
Peptidoglycan biosynthesis and degradation proteins [BR:geo01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Geob_1202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase
Motif
Other DBs
NCBI-ProteinID: ACM19562
UniProt: B9M3R9
LinkDB All DBs
Position
1311183..1313210
Genome map
AA seq 675 aa AA seqDB search
MNFRFCRKVTLFGLLVISMAACIVPSALAQEGFAAYPHLPPSYSSIKVFDSKGQFVGRLL
PEKRYWVSIDRIPAFLQKAVIAVEDSRFYEHNGIDVRGIARALVKDVVKGRMAEGGSTIT
QQLIKNKFLSSEKSIDRKLKEGVMAMDFEKKYTKKQILEMYFNEIYYGNGAWGIAQAARI
YFDKSPQELTEAECSLLAGVPKNPGRYNPLGKAEEVSRRKAVVLKRMADLNMITTRQQQK
LKAQRVAVTRAGQAPYYLAHIKGKLIEQFGPQVIEQGGLEVTAAMDLELQKLAEKTLHDG
VKRISPQMEGALLCLDTNTGDVLAAVGGTDYKQSPYNRAFFAKRQPGSTIKPLIYAAALE
KGIATSSIWSDTPVAYNRGNNEVWKPLNYGREQYGELSLRQALAYSNNVITVKLLDTVGV
PYFVDFAGKVGLPMRAENGLSLALGSDEVTLNELVRAYSPFATGGLRPEPRTIIRIYDRN
RRTWTENPPVITPVLSPATAYISTQMLKDVMTYGTAKGLKKFTQLYPAAGKTGTTDDYRD
AWFVGYTPGIITGVWLGYDKPKPGGKGFTGGTVAAPIWERFMRQAVTSRPVADFQKPEMV
VSVAIDPATGYLAAPDCPDKRDELYIPGTQPTEYCLQHGGESLNPVAMPPVQPEAPEGQP
APEGAQEPIQEEIKE
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
ttgaatttccgtttttgcaggaaagtgacccttttcggcttgctggttatcagcatggct
gcgtgcatcgttccctcggccctggcccaggagggctttgccgcctatccccacctgcct
ccctcatattcctccatcaaggtctttgacagcaaggggcagttcgtcggcagactgctg
ccggagaaaagatactgggtctccatcgatcgcatcccggcgttcctgcagaaggcggtt
atcgctgtagaagactcacgtttttacgagcataacggcatcgatgtgcggggcattgcc
cgggcattggtaaaggatgtggtcaagggcagaatggccgagggggggtcgaccatcacc
cagcagctgatcaagaacaagttcctcagcagcgagaaatccattgaccgcaagctgaag
gaaggggtgatggcgatggattttgaaaagaagtacaccaagaagcagatcctggaaatg
tacttcaacgaaatctattacggcaacggggcctggggcattgcccaggctgcaaggatt
tatttcgataaaagcccccaggagctgaccgaggctgaatgctctttgttggccggggtg
ccgaaaaacccggggcgctacaatcctctgggaaaagcggaagaggtgtccaggcggaaa
gcggtagtcctcaagcgcatggctgatttgaacatgatcactacgcggcagcagcagaag
ctgaaggcccagcgtgttgcagtgaccagagcgggtcaggcaccctattacctggcccat
atcaaggggaaacttatcgagcagttcggaccgcaggttatcgagcagggggggcttgaa
gtgacggcggccatggacctggagctgcagaagctggcggaaaaaaccctgcatgatgga
gtgaagcgcatctcgccacagatggagggagcactgttgtgtctggataccaacaccggc
gatgtacttgccgcagttggcggcaccgattacaaacagagcccctataatcgcgccttc
ttcgccaaacggcagccaggctcgacgattaagcccctgatctatgctgctgccctggaa
aagggaattgcaaccagcagcatctggagcgataccccggttgcctacaaccgtggcaac
aacgaggtgtggaaacccctcaattatgggcgggagcagtatggggagctgagcctgcga
caggccctggcctattccaacaacgtcattaccgtaaagctgctggatacggtcggcgtc
ccgtattttgtcgattttgccggcaaggttggcctgccgatgagggcggaaaacggcctt
tccctggcgctgggcagtgacgaggtgacactgaatgagctggtccgcgcctacagtccg
tttgccaccggcggcctgcgccccgagccgagaacaattatccgcatttatgatcgcaat
cgccgcacctggactgagaatcctcccgtcatcaccccggttctttctccggccactgcc
tatatctccacccagatgctgaaggatgtcatgacctacggtacggccaagggactcaaa
aagttcacccagctgtacccagccgccggcaagaccggtaccaccgacgactatcgggat
gcctggtttgtcggttatactcccgggatcataaccggggtctggctcggctacgacaaa
ccaaaaccggggggcaaaggctttaccggcggcacggtggctgcccccatctgggagcgt
ttcatgcggcaggcggtgacgtcgagaccggttgccgacttccagaaaccggagatggtc
gtttccgtcgccatcgatcccgcgaccggttacctggcggcacccgattgccccgataag
cgtgatgaactctatattccgggcacccagcccactgaatactgtctccagcatggtgga
gagtcattgaaccctgttgctatgccaccggtacaaccggaagcgccggagggacagccc
gcgccggaaggggctcaagagccgatacaggaagagataaaagaatag

DBGET integrated database retrieval system