KEGG   Geobacter daltonii FRC-32: Geob_1219Help
Entry
Geob_1219         CDS       T00846                                 

Gene name
treS
Definition
(GenBank) trehalose/maltose transglucosylase and maltokinase, putative
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
geo  Geobacter daltonii FRC-32
Pathway
geo00500  Starch and sucrose metabolism
geo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:geo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Geob_1219 (treS)
Enzymes [BR:geo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Geob_1219 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Geob_1219 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap APH DUF3459 THB
Motif
Other DBs
NCBI-ProteinID: ACM19579
UniProt: B9M3T6
LinkDB All DBs
Position
1333550..1336894
Genome map
AA seq 1114 aa AA seqDB search
MTGLKDEPLLWYKDAVIYEVHVRSFYDSNGDGIGDFRGLLKKLPFLHDLGVTAVWILPFY
PSPLKDDGYDIADYYRIHPDYGTLGDFQAVLREAHRLGIRIITELVLNHTSDQHAWFQKS
RRGGPRSVWRDFYVWSDTPAKYQDARVIFKDFESSNWSWDPVAKAYFWHRFYSHQPDLNY
DNPRVHEAMLQVLDFWLGMGVDGLRLDAVPYLYEREGTNCENLPETYAFLNKIRQFMDEK
YPGRMLLAEANQWPEDAVSYLGSGACHMAFHFPLMPRMFMALQMEESFPIINILEQTPGI
SEHSQWALFLRNHDELTLEMVTDEERDYMYRVYASDPRARINLGIRRRLAPLMGSDRRKI
ELMNVLLFSLPGTPIIYYGDEIGMGDNYYLGDRNGVRTPMQWSPDRNAGFSAANAQRLFL
PVIIDPEYHYEAVNVENHTRNPSSLLWWMRRLIDLRKQYKAFSRGSLEFVRLRNPKVIAM
IRKFEEETILIFINLSRFSQVVEIASPEFLGHVPEDIFSRNRFPVIKDSPYVLILGPYNY
HLLLMSKAQEAEAPAAEYVCPELSVSGSWENILRRSGLAQMERRVLPGYLRKTRWFRSKG
QTISKLIIGDSLPVPADNTSFFLSFIETAYTEGQTETYLLPLHYLPLTEGEEILQEYPEA
VIARLKVNNEDGILYDAMYSSIFRHVIFGLIAGRKRIEGSEGRVLSGRPGHSFAAIFREK
KAPLQSRVGKVEQSNTAVHFDESFFFKLYRRVEEGVNPEVEIGRFLTEKDRFAHVAPLVG
VLEYWQKGTEPITLGIMQGLVENQGDAWGLTMDEVGEYVERVLASKEDMKVTPRLPANIY
DADHGALSPKMQELMGGFYLEMVPLLGKRTAQLHLALSAHSKYPAFTPEPFSIFNQRSRF
QSMRNRVRTVFDLLKRNLKNLKDEIRQEAEHLLLLEQEIIKKLGKFTGRRFSAMKTRIHG
DYHLGQVLYTGQDFIIIDFEGEPARSMRERRIKDSPLRDVAGMINSFQYAAYAVLVQHAH
IRTEDIPFLEPWAEAWYRYVAGTFLHAYLQNVKGAQFIPSLEADVQTILDIYILDKAIHD
LGYEINNRPDWLLIPLRAIQRLMKNADQAEEMVK
NT seq 3345 nt NT seq  +upstreamnt  +downstreamnt
atgacaggactgaaagacgaacccctcctgtggtacaaggacgccgttatttacgaggtt
cacgtccgaagcttttacgacagcaacggcgatggcatcggcgatttccgcgggctcttg
aaaaagctcccctttctccatgacctgggggtgacggcagtgtggatcctgccgttttat
ccgtcgccactcaaggacgacggctacgacatcgccgattattaccgcatccatcccgat
tacggcaccctcggggacttccaggcggtgctgcgcgaggcccaccggctgggtatcagg
atcattacggagctggtgctgaaccatacctccgatcagcacgcctggttccagaagtcg
cgccggggtgggccacggtcggtgtggcgggatttctacgtctggagcgacaccccggcc
aaatatcaggatgcgcgggtcatcttcaaggatttcgagtcctccaactggtcgtgggat
ccggtggccaaggcctacttctggcaccggttctattcccatcagccggacctgaattac
gataatccacgggtccacgaggctatgctgcaggtcctcgatttctggctcggcatgggg
gtagatggtttaaggctcgatgcggtgccgtacctgtacgagcgggaggggaccaactgc
gagaacctgccggagacctacgcctttctcaacaagatccgccagttcatggacgagaaa
tatccggggcggatgctcctggccgaggccaaccagtggccggaggacgcggtttcctac
ctggggagcggcgcctgccacatggctttccactttcctctcatgccgcgcatgttcatg
gccctgcagatggaggagtcctttcccatcatcaacattctggaacagactccgggcatt
tccgaacattctcaatgggcgctcttcttgcgcaaccacgacgaactgaccctggagatg
gtcaccgacgaggagcgggattacatgtaccgggtctatgccagcgacccccgagcccgc
atcaacctgggtatccgccgtcgcctggcgccgctcatggggagtgaccggcgcaagatc
gagctgatgaacgtgctgctcttttctctgcccggcactcccatcatttattacggcgac
gagatcggcatgggggacaactattacctgggggaccgtaacggcgtccgcacccccatg
cagtggagtcccgaccgcaatgcgggcttttctgctgccaacgcacagcgtctgttcctg
ccggtgatcatcgatcccgagtaccactacgaggcggtcaatgtggagaaccacacccgt
aacccgtcatcgctgttgtggtggatgcggcgtctcatcgatctgcgcaagcagtataag
gccttcagccgtggctcacttgagtttgtccggttacgcaatccaaaagtcattgccatg
atcagaaaattcgaggaggagacaatcctcatcttcatcaacctgtcccgcttttcccag
gtggtggagatagcctctcctgagtttctcggccatgtaccggaggatatcttcagccgc
aatcggttcccggtgatcaaggacagcccctacgtgttgattctcgggccatacaactac
catctcctgctcatgtccaaggcccaggaggcggaggcgcctgcagcggaatatgtgtgt
cccgaattgtcggtaagcggttcctgggagaacatcctgagacggtcaggtttggcccag
atggagcggcgggtgcttcccggctacctgcgaaagacccgctggttccgcagcaaaggg
cagaccataagcaagctgatcatcggcgatagtctgcccgtgccggccgataatacttcc
ttcttcctgagctttatcgagaccgcctacaccgaagggcagaccgagacctatctcctt
cccctgcattacctgccgttgaccgaaggtgaagaaatcctgcaggaataccctgaggcg
gtcattgcccggttgaaggtgaacaatgaagacggcatcctttacgatgccatgtacagc
agcatcttccgtcacgttattttcggcctgatcgcgggaagaaagcgtattgagggatct
gagggaagggtcttgtccgggcgtcccggacattcctttgccgccattttccgggaaaag
aaggcaccgctgcaatccagagtgggcaaggttgagcagagcaacacggctgtccatttc
gacgaaagtttcttcttcaaactttaccggcgcgtggaggaaggggtcaatcccgaggtg
gaaattggcagattcctgacggaaaaggatcgctttgcccatgttgcaccgctggtcggg
gtactggagtattggcagaaagggacggaaccgatcacccttggtatcatgcaagggctg
gtagagaaccagggggatgcctgggggctgaccatggacgaggttggggaatacgtggaa
cgggtcctggcaagcaaggaggatatgaaggtgacgccgcggctgccggccaatatctat
gatgccgatcacggggcgctttcaccgaaaatgcaggaactgatgggaggcttttatctg
gagatggtgcccctcttaggcaagaggacggcccagctgcatctggccctgtctgcccac
agcaaatacccggcttttaccccggagccattttccatcttcaaccagcgctcgcgtttc
cagtccatgcgcaacagggtccgcaccgtcttcgatcttctgaagcggaacctgaaaaac
ctcaaggacgagatccggcaggaggcggaacacttgctcttgctggaacaggaaatcatc
aaaaagctcggcaaatttaccggccgccggttttctgcaatgaaaacacgcatccatggg
gattatcacctgggacaggtgctctatacgggccaggatttcatcatcatcgatttcgag
ggggaaccggcgcgttccatgcgggaaagaaggatcaaggattcgccgctcagggacgtt
gccggcatgatcaattcgttccagtatgcggcctatgcagtgctggtgcagcatgcccat
atccgtaccgaggatattcctttcctggagccatgggccgaagcctggtaccgttacgtg
gccggcactttcctccatgcctatctgcaaaatgtgaaaggtgcccaatttatccccagc
ctggaggcggacgtacagaccatcctcgacatatacatcctggacaaggcgatccatgac
ctgggctatgagatcaacaaccgtcccgactggctgttgatacctctgcgcgctattcag
cgtctgatgaagaatgcggatcaggcagaagagatggtcaaatga

DBGET integrated database retrieval system