KEGG   Geobacter daltonii FRC-32: Geob_1628Help
Entry
Geob_1628         CDS       T00846                                 

Gene name
tupC-2
Definition
(GenBank) tungstate ABC transporter, ATP-binding protein
  KO
K06857  tungstate transport system ATP-binding protein [EC:7.3.2.6]
Organism
geo  Geobacter daltonii FRC-32
Pathway
geo02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:geo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Geob_1628 (tupC-2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:geo02000]
    Geob_1628 (tupC-2)
Enzymes [BR:geo01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.6  ABC-type tungstate transporter
     Geob_1628 (tupC-2)
Transporters [BR:geo02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Tungstate transporter
    Geob_1628 (tupC-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 AAA_23 AAA_16 RsgA_GTPase SbcCD_C AAA_22 Zeta_toxin SMC_N AAA_15 AAA_13 NACHT
Motif
Other DBs
NCBI-ProteinID: ACM19986
UniProt: B9M605
LinkDB All DBs
Position
complement(1796719..1797402)
Genome map
AA seq 227 aa AA seqDB search
MNTLFTLRSIRKFYRNNIVLDLDHLDIHQGRCYLLTGQNGAGKSTLLNILAFLSPPTSGD
ISFEGHGVDWKSRTLLACRQKVTLLHQSPYLFAGTVFANVAYGLNARKIPHGLQQQLVDE
ALDSVGLSGFQARPVLDLSGGEAQRVAMARALILKPLVLLLDEPFSSVDRKTAEMMENIL
ASLPQGGTTVIMATHEPPREPLLFAESIHLVQGRLAGSPQVNCLTAA
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgctcttcactttgagatcgattcgtaagttctacaggaataatatagtactt
gacctggatcatctggatattcatcaagggcgctgttatctgctgaccggtcagaacgga
gccggcaaaagcaccctgctgaacatcctggcttttctttcgccacccacttcgggagat
atctctttcgaggggcacggggttgattggaaaagccgcaccttgcttgcctgcagacaa
aaagtgaccctgctccatcaatccccgtatctttttgccgggaccgtctttgccaatgtg
gcttatggactcaatgcccgcaagataccccatggactgcaacagcagctggttgatgaa
gccctcgactcggtcggactgagtggctttcaggcgaggccggttctggacctctccggg
ggcgaagcacagcgggtggcaatggcaagggccctgatactgaaaccgctggtgctgctg
ctcgatgagccgtttagcagcgtcgacaggaaaactgcggaaatgatggaaaacatattg
gcttccctccctcaaggaggaacgacggtgatcatggcaacccatgaacctccgcgggag
cctctgctctttgccgaaagcattcacctcgtccagggaaggctggcaggctcaccgcaa
gttaattgccttactgctgcatag

DBGET integrated database retrieval system