KEGG   Geobacter daltonii FRC-32: Geob_3278Help
Entry
Geob_3278         CDS       T00846                                 

Definition
(GenBank) NADPH-dependent glutamate synthase, iron-sulfur cluster-binding subunit
  KO
K00196  anaerobic carbon-monoxide dehydrogenase iron sulfur subunit
Organism
geo  Geobacter daltonii FRC-32
Pathway
geo00680  Methane metabolism
geo01100  Metabolic pathways
geo01120  Microbial metabolism in diverse environments
geo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:geo00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Geob_3278
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Geob_3278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_11 Fer4_7 Fer4_9 Fer4 Fer4_6 Fer4_2 Fer4_10 Fer4_4 Fer4_21 Fer4_16 Fer4_3 Fer4_17
Motif
Other DBs
NCBI-ProteinID: ACM21621
UniProt: B9M4T7
LinkDB All DBs
Position
complement(3604498..3604947)
Genome map
AA seq 149 aa AA seqDB search
MKRIYSIEDACIGCHLCEVACITEHSKSKDPIKAFLHEPERPIARCTVEEIDSGVVSFST
NCRHCDEPDCLRACISGAIQKLDDGRVLMDTDKCVGCWSCVMACPYGAVQRNLNKKKGNK
CDLCPDRQSPACVDACPNRALVYKEGSQK
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaatctatagcatcgaagacgcctgtatcggttgccatctctgcgaggtggcc
tgcattaccgagcactcaaaatcgaaagatcccatcaaggcttttctccatgagcctgag
cgtcccatcgcgcgctgtacggtggaggagattgacagcggagtggtgtcgttttccaca
aactgccgccactgtgacgagcccgattgcctcagggcctgcatctccggcgccattcag
aaactggatgacggcagggtgttaatggacacggataaatgtgtcggttgctggtcctgt
gtcatggcttgtccctatggagcggttcagcgtaacctgaacaaaaagaagggcaataaa
tgtgatctttgccccgatcggcagagcccggcctgtgttgacgcatgccccaaccgggcc
ctcgtttacaaggaggggagccagaaatga

DBGET integrated database retrieval system