KEGG   Gemella sp. ND 6198: CG018_01240
Entry
CG018_01240       CDS       T05584                                 

Definition
(GenBank) iron ABC transporter ATP-binding protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
geq  Gemella sp. ND 6198
Pathway
geq00010  Glycolysis / Gluconeogenesis
geq00020  Citrate cycle (TCA cycle)
geq00620  Pyruvate metabolism
geq01100  Metabolic pathways
geq01110  Biosynthesis of secondary metabolites
geq01120  Microbial metabolism in diverse environments
geq01200  Carbon metabolism
Module
geq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:geq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CG018_01240
   00020 Citrate cycle (TCA cycle)
    CG018_01240
   00620 Pyruvate metabolism
    CG018_01240
Enzymes [BR:geq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CG018_01240
SSDB
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 PYNP_C QRPTase_N
Other DBs
NCBI-ProteinID: AXI26161
LinkDB
Position
complement(266320..267711)
AA seq 463 aa
MAVEVIMPKAGSEMEEGEIVQWFKKEGDHVEAGEVLLEIVTDKVNMEVEADASGTLLKIL
AQAGDVVPVVQTIAWIGEKGEEIPGASATGEVAPAETIVEKKVDVTPVKEIEKIDYSGLR
ATPAARAYAREKGIDLAKVKGTGAKGRIHKEDVLEYKLNSKVKISPLAERIAEIEGVSTT
GIVGTGPNGKIMKADVLAVLHGTPKAAPVKKEEVAPAKAKKAPLAPNENQWGVVETVPMS
PMRKVISKRMSESYFSAPTFVVNVEVDMTELLALRKKVVDTIIEETGKKATVTDFISLAV
IKSLMKHPYVNASLSKDEKEMYLHHYVNLSIAVGMDSGLVVPVIKGADKMSLKELVVASK
EITTKALNGKLKPDEMADSTFTISNLGMYGVKSFVPIINQPNTAILGVSATVPKPVVMNG
EIVVRPIMTLTLTADHRVVDGLEGAKFMKTLKEAIENPLSLLI
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggcagtagaggttattatgccaaaagccggcagtgaaatggaagagggcgaaatcgta
caatggtttaaaaaagaaggagatcatgtagaagcaggagaagtcctattagaaatcgtc
actgataaagtaaatatggaagtagaagctgacgctagcggtacacttttaaaaatattg
gcacaagctggggatgtagtccctgtggtacaaactatcgcatggataggggaaaaagga
gaagaaattcccggagcaagtgcaacaggagaggtagcaccagcggaaacaatagtagag
aaaaaagttgatgtgacgccggttaaggaaatagaaaaaatagattattcaggattgcgt
gcaacacctgcggcaagagcgtatgcacgtgaaaaaggaattgatttagcaaaagttaaa
ggaacaggtgctaaaggacgtattcacaaagaagatgtacttgaatataaacttaacagc
aaggtgaaaatttctccgttagcagaacgtattgctgaaattgagggagttagtacaaca
ggtattgtcggtacgggaccaaacggtaagattatgaaagcagatgtgcttgcagtgctt
catggtacaccgaaagcggcaccggtgaaaaaagaagaggtagcaccggcaaaagctaaa
aaagcgccgcttgcacctaatgaaaatcaatggggcgttgttgaaacggtacctatgtcg
ccgatgcgtaaagttatttctaaacgtatgagtgaatcttatttcagcgcaccgactttt
gtagttaatgttgaagtggatatgacggaactattagcattacgtaaaaaagttgttgat
acaatcatagaagaaacaggtaaaaaagcaacggtaactgactttatttcattagcagtt
attaaatcattgatgaaacatccgtatgtaaatgcttcattatcaaaagatgagaaagag
atgtatctacatcattatgtaaacttatcaatagctgtaggtatggacagcggattagtg
gtaccggtaattaaaggtgcagataaaatgagtcttaaagagttagtggtagcttctaaa
gaaattacaacaaaagctcttaacggaaaattaaaaccggacgaaatggctgattcaaca
tttacaatcagtaatttaggtatgtacggtgttaaaagttttgtacctattataaaccaa
cctaatacagcaattttaggtgttagtgcaactgtaccgaaaccggttgtaatgaacggc
gaaatagttgtaagaccgattatgactcttaccttaacagcagatcaccgtgtagtagac
ggattagagggggctaaattcatgaagacattgaaagaagctattgaaaatccactatca
ttactaatctaa

DBGET integrated database retrieval system