KEGG   Gemella sp. ND 6198: CG018_01240Help
Entry
CG018_01240       CDS       T05584                                 

Definition
(GenBank) iron ABC transporter ATP-binding protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
geq  Gemella sp. ND 6198
Pathway
geq00010  Glycolysis / Gluconeogenesis
geq00020  Citrate cycle (TCA cycle)
geq00620  Pyruvate metabolism
geq01100  Metabolic pathways
geq01110  Biosynthesis of secondary metabolites
geq01120  Microbial metabolism in diverse environments
geq01130  Biosynthesis of antibiotics
geq01200  Carbon metabolism
Module
geq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:geq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CG018_01240
   00020 Citrate cycle (TCA cycle)
    CG018_01240
   00620 Pyruvate metabolism
    CG018_01240
Enzymes [BR:geq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CG018_01240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 PYNP_C QRPTase_N
Motif
Other DBs
NCBI-ProteinID: AXI26161
LinkDB All DBs
Position
complement(266320..267711)
Genome map
AA seq 463 aa AA seqDB search
MAVEVIMPKAGSEMEEGEIVQWFKKEGDHVEAGEVLLEIVTDKVNMEVEADASGTLLKIL
AQAGDVVPVVQTIAWIGEKGEEIPGASATGEVAPAETIVEKKVDVTPVKEIEKIDYSGLR
ATPAARAYAREKGIDLAKVKGTGAKGRIHKEDVLEYKLNSKVKISPLAERIAEIEGVSTT
GIVGTGPNGKIMKADVLAVLHGTPKAAPVKKEEVAPAKAKKAPLAPNENQWGVVETVPMS
PMRKVISKRMSESYFSAPTFVVNVEVDMTELLALRKKVVDTIIEETGKKATVTDFISLAV
IKSLMKHPYVNASLSKDEKEMYLHHYVNLSIAVGMDSGLVVPVIKGADKMSLKELVVASK
EITTKALNGKLKPDEMADSTFTISNLGMYGVKSFVPIINQPNTAILGVSATVPKPVVMNG
EIVVRPIMTLTLTADHRVVDGLEGAKFMKTLKEAIENPLSLLI
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagaggttattatgccaaaagccggcagtgaaatggaagagggcgaaatcgta
caatggtttaaaaaagaaggagatcatgtagaagcaggagaagtcctattagaaatcgtc
actgataaagtaaatatggaagtagaagctgacgctagcggtacacttttaaaaatattg
gcacaagctggggatgtagtccctgtggtacaaactatcgcatggataggggaaaaagga
gaagaaattcccggagcaagtgcaacaggagaggtagcaccagcggaaacaatagtagag
aaaaaagttgatgtgacgccggttaaggaaatagaaaaaatagattattcaggattgcgt
gcaacacctgcggcaagagcgtatgcacgtgaaaaaggaattgatttagcaaaagttaaa
ggaacaggtgctaaaggacgtattcacaaagaagatgtacttgaatataaacttaacagc
aaggtgaaaatttctccgttagcagaacgtattgctgaaattgagggagttagtacaaca
ggtattgtcggtacgggaccaaacggtaagattatgaaagcagatgtgcttgcagtgctt
catggtacaccgaaagcggcaccggtgaaaaaagaagaggtagcaccggcaaaagctaaa
aaagcgccgcttgcacctaatgaaaatcaatggggcgttgttgaaacggtacctatgtcg
ccgatgcgtaaagttatttctaaacgtatgagtgaatcttatttcagcgcaccgactttt
gtagttaatgttgaagtggatatgacggaactattagcattacgtaaaaaagttgttgat
acaatcatagaagaaacaggtaaaaaagcaacggtaactgactttatttcattagcagtt
attaaatcattgatgaaacatccgtatgtaaatgcttcattatcaaaagatgagaaagag
atgtatctacatcattatgtaaacttatcaatagctgtaggtatggacagcggattagtg
gtaccggtaattaaaggtgcagataaaatgagtcttaaagagttagtggtagcttctaaa
gaaattacaacaaaagctcttaacggaaaattaaaaccggacgaaatggctgattcaaca
tttacaatcagtaatttaggtatgtacggtgttaaaagttttgtacctattataaaccaa
cctaatacagcaattttaggtgttagtgcaactgtaccgaaaccggttgtaatgaacggc
gaaatagttgtaagaccgattatgactcttaccttaacagcagatcaccgtgtagtagac
ggattagagggggctaaattcatgaagacattgaaagaagctattgaaaatccactatca
ttactaatctaa

DBGET integrated database retrieval system