KEGG   Gemella sp. ND 6198: CG018_03755Help
Entry
CG018_03755       CDS       T05584                                 

Definition
(GenBank) hypothetical protein
Organism
geq  Gemella sp. ND 6198
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNARE_assoc OAD_gamma DUF2116
Motif
Other DBs
NCBI-ProteinID: AXI26587
LinkDB All DBs
Position
complement(827192..828388)
Genome map
AA seq 398 aa AA seqDB search
MKRLRLLFYFTTIGIALGYFFAVLLSFFVQYAMLADESLIMYVWTLYGIMTGFVFKKIGN
KYGFFIIEGLVLIMMLIAGRMNILFYITKEALGLTSVKQIHTPLLVIIVLINIINFYIVY
TRSKYQKVYSREELKKIKEEEVKLSDLREVNPEEEAKRKKQRRNARIITIVAFALFFAIY
FTVPSFKSGINTAFATLSQFDTNAVIEYLRSWGAWAAVVSFILMILQSIAAPIPAFLITL
SNAAIFGWVIGAVLSWSSAMAGAAVCFYIARGLGRDVVEKLTSKGAMASIDVFFERYGDR
AILICRLLPFVSFDFVSYAAGLTNMGFWKFFIATGIGQLPATIIYSYVGGTLSGGARNLF
IGLMCLFALSIVIGIMKKIYNDKHKKEEEKQKTGEMVK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtttaagattactattttacttcactactattggaatagccttaggttatttt
tttgcagtgttgctgtcatttttcgttcaatatgcaatgttagctgatgaaagtcttata
atgtatgtttggacgctatatggtattatgacaggttttgtctttaaaaaaatcggcaac
aaatatggattcttcattattgaaggacttgttttaataatgatgcttattgccggtaga
atgaatattctattttatattactaaagaagcacttggattaacgtcagttaaacagatt
catacaccgcttcttgttatcattgtactgataaatattattaacttctatatagtctac
actcgttctaaatatcaaaaagtttatagtcgtgaagagcttaaaaaaattaaggaagaa
gaggttaaacttagtgacttacgtgaagtaaatccggaagaagaagctaaacgtaaaaaa
caacgtagaaatgcacgtattattactattgttgccttcgcactgttctttgcaatttat
tttactgtccctagttttaaatcaggaattaacacggcatttgcaacgctatcacagttt
gatactaatgctgttattgagtatcttcgtagttggggagcgtgggcagccgtagtatca
tttattttaatgattttacaatcaatcgccgctcctataccggcattcttaattacatta
tctaatgctgctattttcggttgggtaatcggtgctgtcctttcttggtcatctgccatg
gcaggtgctgctgtgtgtttctatatagcacgtggtttaggtcgtgatgttgttgaaaaa
ttaacaagtaaaggtgctatggccagtattgatgttttcttcgaacgttatggagatcgt
gctattttaatctgtcgtttattaccgtttgtatcattcgactttgtcagttatgctgcc
ggtttaaccaatatgggattctggaaattctttattgcgacaggtatcggacaacttccg
gcaactatcatttattcttatgttggaggtacactttcaggcggagcaagaaatctgttt
ataggtttaatgtgtctattcgccctatctatcgtaatcggtattatgaaaaaaatatac
aatgataagcacaaaaaagaagaagaaaaacaaaaaaccggtgaaatggtaaaataa

DBGET integrated database retrieval system