KEGG   Gemmata sp. SH-PL17: VT84_14855Help
Entry
VT84_14855        CDS       T04358                                 

Gene name
glgP_1
Definition
(GenBank) Glycogen phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
ges  Gemmata sp. SH-PL17
Pathway
ges00500  Starch and sucrose metabolism
ges01100  Metabolic pathways
ges01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ges00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VT84_14855 (glgP_1)
Enzymes [BR:ges01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     VT84_14855 (glgP_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase Capsule_synth
Motif
Other DBs
NCBI-ProteinID: AMV25675
UniProt: A0A142XFE5
LinkDB All DBs
Position
3423620..3426178
Genome map
AA seq 852 aa AA seqDB search
MAGRSIRSFTVLPRLPDRLRPLQALAYNLWWCWNADAVALFRRVNPDLFEALDHSPIRLL
GATDQSRFEELEHDDGFLAHMDRVARALDHYLKAPTWYQEHHAGDKARIAYFSAEFGIHE
SVPVYSGGLGVLAGDHLKSASDLGLPLTGITLMYREGYFRQYLNVDGWQQERYPENDFFT
LPLTPELDSTGAPLTVTVPLPGREVALRVWHIQVGRVPLYLLDANIPQNKPEDRAITAQL
YGGDQHTRIQQEIILGIGGIRALRAMNKMPTVCHMNEGHAAFTGLERIRLLIEEEGLDFA
TAYEAVKAGTCFTTHTPVPAGNDSFPIHMAEQYLGEYAAKMGLDRNALVALGRQHPGNEQ
EPFGMTVLALKVANVSNGVSKLHGSVSRRMWKELWPELPAGEVPITSITNGVHTQSWLAP
EFAQLYDRYLGIQWEERPTDFAIWKRVEHIPDGELWRTHERGRERLVALARARLRAQLKR
RGSPPSEVEGADEVLDPDALTIGFARRFATYKRGDLIFRNAERIAALVNSKDRPVQFIFA
GKAHPQDRGGKELIQRVVQQSRKPEFRKRVVFIEDYDMSVARYLVQGVDVWLNNPRRPLE
ASGTSGMKICGNGGLNLSILDGWWVEGYDGDNGWAIGAGEEYTDLAYQDEVESRALLDLI
EQDIAPTFYKRDAGGLPREWIRRMKRSIMSLVPVFNTNRMVEQYTERCYVPSHRRAAKLS
ANHLQGAKELAAWRRRVGSEWGQVRIEAVDAPTGEALRVGATFPVKVRVNLGTLRPDDVE
VQLCYGVLDALGDIADPKSLPLESNGSGGGASVLFAGEVPCRASGQFGFGVRVLPKNANL
PHLFEPGMVTWG
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atggccggccgctctatccgctcgttcacggttctgccccgccttcccgaccgcctccgt
ccgctccaggcactcgcgtacaacctctggtggtgttggaacgcggacgcggtcgcgctg
ttccggcgcgtgaacccggacctgttcgaggcgctcgaccatagcccgatccgcctgctc
ggtgcgaccgaccagagccgcttcgaggagctcgagcacgacgacgggttcctggcccac
atggaccgcgtggcgcgggcactggaccattacctgaaagctccgacgtggtaccaggag
caccacgccggggacaaggcccgaatcgcgtatttctcggccgagttcggtattcacgag
agcgtgccggtgtactcgggcggcctgggggtgctggccggcgaccacctcaagagtgcc
agcgacctcgggctgcctcttaccggcatcacgctgatgtaccgcgaggggtacttccgc
cagtacctcaacgtggacggctggcagcaggagcggtacccggagaacgacttctttacc
ctgccgctcacaccggaactcgactccaccggcgcgccgctcacggtcacggtaccgctc
ccggggcgcgaggtggcgctgcgcgtgtggcacatccaggtcggtcgggtgccgctgtat
ctgctcgacgcgaacatcccgcagaacaagcccgaagatcgggcgatcacggcgcagctc
tacggcggcgaccagcacacgcgcatccagcaagaaattatcctcgggatcggcggcatc
cgcgcgctgcgggcgatgaacaagatgcccaccgtgtgccacatgaacgaggggcacgcc
gcgttcaccgggctggagcgcatccggctcctgatcgaagaagaggggctggacttcgcg
accgcttacgaggccgtcaaagccgggacgtgcttcaccacgcacaccccggtgcccgcg
ggcaacgactcgttccccatccacatggcggaacagtacctcggtgagtacgcggcgaag
atggggctcgaccggaacgcgctcgtcgcgctggggcgccagcaccccggcaacgagcag
gaaccgttcgggatgacggtcctggcgctcaaagtggccaacgtgtccaacggtgtgagc
aaactgcacggcagcgtgtcgcgccggatgtggaaggaactgtggcccgaactgcccgcc
ggcgaggtgccgatcaccagcatcaccaacggcgtccacacgcagagctggctcgcgccg
gagttcgcacagctctacgatcgctacctcggcatccagtgggaggagcgcccgaccgac
ttcgccatttggaagcgagtggagcacatcccggacggcgaattgtggcgcacgcacgag
cgcgggcgcgagcggctcgtcgcgctggcccgggcgcgattgcgtgcgcagctcaagcgc
cgtggatcgccgccctcggaagtggagggggccgacgaggtactcgatccggacgcgctg
acgatcgggttcgcgcgccggttcgccacctacaagcgcggcgacctcattttccgcaac
gcggagcgcatcgcggccctggtaaacagcaaggaccgcccggtgcagttcatcttcgcg
ggcaaggcccacccgcaggaccgcggcggtaaagagctgatccagcgcgtcgtgcagcag
tcgcgcaagcccgagttccgcaagcgcgtcgtgttcatcgaggactacgacatgagcgtc
gcgcggtacctcgtgcagggcgtggacgtgtggctcaacaacccgcgccgcccgctcgaa
gcgtcgggcacgagcggcatgaagatttgcggcaacggcgggctgaacctgagcatcctc
gacggctggtgggtcgaggggtacgacggcgacaacggctgggcgatcggcgcgggcgag
gagtacaccgacctcgcgtaccaggacgaggtcgagagccgcgcgctgctcgatctcatc
gagcaggacatcgcgccgacgttctacaagcgcgacgcgggcgggctcccgcgcgagtgg
atccggcgcatgaagcgctcgatcatgagcctcgtgccggtgttcaacacgaaccggatg
gtggagcagtacaccgagcggtgctacgtgccgagccaccggcgcgcggcgaaactgagc
gcgaatcacctccagggcgcgaaggaactggccgcgtggcgccggcgcgtggggagcgaa
tggggtcaggtgcgaatcgaggccgtggacgccccgacgggcgaggcgctccgcgtgggc
gcgacattcccggtaaaggtgcgagtcaacctcggtaccctgcgtcccgacgacgtcgag
gttcaactgtgctatggcgtgctcgacgcgctaggcgacatcgctgacccgaagtcgctc
ccgctggagtcgaacggctctgggggcggagcgagcgtgctgttcgcgggcgaagttccg
tgtcgcgcgagtggccagttcgggttcggggtccgcgtgctgccgaagaacgcgaacctg
ccgcacctgttcgagccgggcatggtgacgtggggttaa

DBGET integrated database retrieval system