KEGG   Gemmata sp. SH-PL17: VT84_21805Help
Entry
VT84_21805        CDS       T04358                                 

Gene name
ddl_2
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ges  Gemmata sp. SH-PL17
Pathway
ges00550  Peptidoglycan biosynthesis
ges01100  Metabolic pathways
ges01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ges00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VT84_21805 (ddl_2)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VT84_21805 (ddl_2)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    VT84_21805 (ddl_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ges01011]
    VT84_21805 (ddl_2)
Enzymes [BR:ges01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     VT84_21805 (ddl_2)
Peptidoglycan biosynthesis and degradation proteins [BR:ges01011]
 Precursor biosynthesis
  Amino acid ligase
   VT84_21805 (ddl_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_4 ATP-grasp_3 ATPgrasp_Ter ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AMV27053
UniProt: A0A142XJ57
LinkDB All DBs
Position
complement(5146025..5147092)
Genome map
AA seq 355 aa AA seqDB search
MTAPSVLILYNEPVLPADHPDAGSEHDILDTVNDTFKVLKAAGFETTKLGINYDPQPLLD
VLKKARPDAVFNLFEGIATQTSTEVSVAALLEWLNVPFTGCPSPALALGRDKIRTKHILA
ATGIPTPDYAIIDALPVPLWVHPWPAIVKPAYQDASVGINQESVVTSQAQLEDRVAHVLA
TYGPPALVERYVSGREFHVNMIEDPGAAPNAPPLVLPLAEIAFKNDRPGKWAVYTFIAKW
DEHSDEYQSAPLRAPVTIPADDFARLSVIAQRSFRALQCRDYARIDVRMDADGNFYVLEV
NPNPYLNSLALVNGLVAIGRTHEELLVKLTTAALLRSGKEISFDAIRVPVNVVTA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgccttccgtactcatcctctacaacgaacccgtgctcccggccgatcacccg
gacgccgggtccgagcacgacatcctcgacaccgtcaacgacacgttcaaggtgctcaag
gccgcggggttcgagaccaccaagctcggcatcaactacgacccgcaaccgctcctcgac
gtgctcaagaaggcgcgccccgacgcggtgttcaacctgtttgagggcatcgccacccag
acctcgacggaagtgtcggttgctgcactactcgaatggctgaacgtgccgtttaccggg
tgcccgtcgcccgcgctggcactcgggcgcgacaagatccggaccaagcacatcctcgcc
gcgaccggaatcccgacgccggattacgcgatcattgatgcgctgccggtccctctctgg
gtccacccgtggcccgcgatcgtgaagcccgcgtaccaggacgcgagcgtcggcatcaat
caggagagtgtggtcacgtcccaggcgcaactcgaagaccgcgtggcgcacgtgttggcg
acctacgggcctcctgcactcgtggagcgctacgtgtccggacgcgagttccacgtgaac
atgatcgaagacccgggggccgcgccgaacgccccgccgctcgttttgccgctcgccgag
atcgcattcaagaacgaccggccggggaagtgggccgtatatacgttcatcgccaagtgg
gacgagcacagcgacgagtaccagtccgcgccgctgcgtgcgccggtcacgatcccggcc
gacgatttcgcccggctctcggtcatcgcgcagcgctcgttccgcgcgctccagtgccgc
gactatgcccgcattgacgtgcgcatggacgcggacggcaacttctacgttctggaagtg
aacccgaacccgtatctgaatagcctcgcgctcgtgaacggcttggttgcgatcgggcgt
actcacgaggaactcctggtcaaactcacgacggcggcccttttacggagcgggaaggag
atctcgtttgacgcgatccgcgttccggtgaacgtcgtcacggcgtga

DBGET integrated database retrieval system