KEGG   Gemmata sp. SH-PL17: VT84_28535Help
Entry
VT84_28535        CDS       T04358                                 

Gene name
prkC_34
Definition
(GenBank) Serine/threonine-protein kinase PrkC
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ges  Gemmata sp. SH-PL17
Brite
KEGG Orthology (KO) [BR:ges00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ges01001]
    VT84_28535 (prkC_34)
Enzymes [BR:ges01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     VT84_28535 (prkC_34)
Protein kinases [BR:ges01001]
 Serine/threonine kinases: Other
  Bacterial family
   VT84_28535 (prkC_34)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal Kdo Haspin_kinase Kinase-like FTA2 ABC1
Motif
Other DBs
NCBI-ProteinID: AMV28385
UniProt: A0A142XNB4
LinkDB All DBs
Position
complement(6716618..6718255)
Genome map
AA seq 545 aa AA seqDB search
MPDTQPQTAPQQPDLTGRTLGDFHILRRIGAGGMGQVYLARQTSLKREVALKLLRDELNA
NLTALARFQAEAQAVAKLNHPNIVHIHQIGESDGVRYMVLEFVEGRNLRDYLARKGPPDL
PIALSVVRQVTLALQKAHEQGIVHRDIKPENILVTRKVEVKVTDFGLSRFFAGETPATNI
TQSGVTLGTPLYMSPEQVQGHAVDHRSDIYSFGVTCFHLLAGEPPFRGTSAFDVALKHVQ
EQPRQLSGLRPDLPTELCGMVHKMMAKKPEDRYQSARDVLRDLMKVRGGLMTGTAQFSLS
QNTGKVLALGAGDSSSLLTQAPVLSSEHRGRWGQWLLIGAACVLAAVGGVFLYAGTNPSA
DAAHTPSGASSGPGLPDVRSPDRLNTTRERELLVVLNTEGTKPDDAIKASVELGLLYVKE
RRLPEANDRFERLRGREREWRDPIAARTAGVAGRLGLAVVLAHENKPEPSNKLFLDVAQD
QPKFGGPGMPKFERPTFSVSGTLLRYPDLSHAVSDALNRNATNLGKTRLEPAVLEQLRSP
QRVGK
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgccggatacccagccgcaaaccgcgccgcagcaaccggacctgaccggccgcacgctg
ggggacttccacatcctccgccggatcggagcgggcggtatggggcaagtgtacctcgcc
cgccaaacgtcgctgaaacgcgaggtcgcgctcaaactgctccgcgacgagttgaacgcg
aacctcaccgcgctggctcggttccaggccgaggcccaggcggtcgcgaagctcaaccat
cccaacatcgttcacatccaccagatcggcgagtccgacggggtccggtacatggtgctg
gagttcgtggaggggcgcaatctccgcgactacctggcgcgcaagggaccgcccgatctg
ccgattgccctgagtgtggtgcggcaagtcacgctcgcgctccagaaggcccacgaacag
ggcatcgttcaccgcgacatcaagcccgagaacatcctggtgacgcggaaggtcgaggtg
aaggtcaccgacttcggtctgagccggttcttcgcgggggaaacgccggccacgaacatc
acgcagagcggcgtcacgctcggtacgcccctgtacatgtccccagaacaggtgcagggg
cacgcggtcgatcaccgcagcgatatctattccttcggcgtgacgtgctttcacctcctc
gcgggggagccaccatttcggggcacgtctgcgttcgatgtggcgctgaagcacgttcag
gagcaaccgcgccagctctcaggcttgcggcctgacctgcccacggaactgtgcggcatg
gtccacaagatgatggcgaagaagccggaggatcgctatcagtccgcgcgcgacgtgctc
cgcgacctgatgaaggtgcgcggcgggttaatgacggggaccgcgcaattttccctctct
caaaacaccgggaaggtgcttgcgctgggagcgggcgactcgtcgtccttgctcacgcaa
gctcccgtgctctcttccgaacaccgagggcggtggggtcagtggctcctgatcggggcc
gcgtgcgtgctcgccgcggtcgggggggtgttcctgtacgccggcacgaacccgtccgcc
gacgccgcgcacacgccgtcgggcgcgagtagtggtccggggttgcccgacgtgcgctcc
ccggaccggctcaacacgacgcgcgagcgcgagttgctcgtggttcttaacaccgagggc
acgaaaccggacgacgcgatcaaggcgtccgtcgaactcgggctgctctacgtgaaggaa
cggcgcttaccggaagccaacgaccggttcgagcgccttcgcggtcgcgagcgggagtgg
cgcgacccgatcgctgcacgcactgccggtgtcgcggggcgtttggggctggcggtggtg
ctggcccacgagaacaagccggagccgtcgaacaagctgtttttggatgtggcacaggac
caaccgaagttcggtggtcccggcatgccgaagttcgagcgcccgacgttcagcgtgagc
ggcacgctcctccgctacccggacctgagtcacgccgtttcggacgcactcaaccgtaac
gccacgaacctcggcaagacccggctcgaacccgctgtgctagagcaactccgttcccca
cagcgcgttgggaagtag

DBGET integrated database retrieval system