KEGG   Gemmata sp. SH-PL17: VT84_32325Help
Entry
VT84_32325        CDS       T04358                                 

Gene name
betB_2
Definition
(GenBank) NAD/NADP-dependent betaine aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ges  Gemmata sp. SH-PL17
Pathway
ges00010  Glycolysis / Gluconeogenesis
ges00053  Ascorbate and aldarate metabolism
ges00071  Fatty acid degradation
ges00280  Valine, leucine and isoleucine degradation
ges00310  Lysine degradation
ges00330  Arginine and proline metabolism
ges00340  Histidine metabolism
ges00380  Tryptophan metabolism
ges00410  beta-Alanine metabolism
ges00561  Glycerolipid metabolism
ges00620  Pyruvate metabolism
ges00625  Chloroalkane and chloroalkene degradation
ges00903  Limonene and pinene degradation
ges01100  Metabolic pathways
ges01110  Biosynthesis of secondary metabolites
ges01120  Microbial metabolism in diverse environments
ges01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ges00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VT84_32325 (betB_2)
   00053 Ascorbate and aldarate metabolism
    VT84_32325 (betB_2)
   00620 Pyruvate metabolism
    VT84_32325 (betB_2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VT84_32325 (betB_2)
   00561 Glycerolipid metabolism
    VT84_32325 (betB_2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VT84_32325 (betB_2)
   00310 Lysine degradation
    VT84_32325 (betB_2)
   00330 Arginine and proline metabolism
    VT84_32325 (betB_2)
   00340 Histidine metabolism
    VT84_32325 (betB_2)
   00380 Tryptophan metabolism
    VT84_32325 (betB_2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VT84_32325 (betB_2)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VT84_32325 (betB_2)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    VT84_32325 (betB_2)
Enzymes [BR:ges01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     VT84_32325 (betB_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AMV29126
UniProt: A0A142XQ77
LinkDB All DBs
Position
complement(7571736..7573223)
Genome map
AA seq 495 aa AA seqDB search
MATATAPATKPARTKPRVVDQKMLIGGKWVNSASGKTFATTDPTDGSVICNIAEGDKADI
DLAVRAAREAFENGPWARMNASERGRLLNKLADAVEEHKEELAALESLDNGKPLNDAMGA
DLPLSIACYRYYAGWADKIFGQTIPINGPFFTYTRHEPIGVVGQIIPWNFPLLMQAWKWG
PALACGNTLVLKPAEQTPLTALRVAQLAQEVGFPDGVINVVPGYGPTAGAALSGHMDVDK
IAFTGETGTGKIVMTAAAQSNLKRVSLELGGKSPNIVFADADLDAAVEGAYFGLFFNQGQ
CCCAGSRLFVQDSVYDAFVAKIVEKAKGRKVGDPFASDTEQGPQVSQEQFDRVLGYIAAG
QKDGAKMLTGGGRVGEKGYFVQPTVFGDVKDDMKIAQEEIFGPVMSILRFKDTDEVIARG
NRTQYGLAAAVWTKDVKKALRLANGLRAGTVWVNCFDVFDAGAPFGGFKMSGIGRELGQY
ALQLYTEVKTVTMAM
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgccaccgcgcccgccacgaaacccgctcgcaccaagccccgcgtcgtcgat
cagaagatgctgatcggcggcaagtgggtgaacagcgcgagcgggaagacgttcgccacc
accgacccgacggacgggtcggtcatctgcaacatcgcggagggggacaaggccgacatc
gatctcgcggttagggccgcgcgcgaggcgtttgaaaacggaccgtgggcgcgcatgaac
gcgagcgaacgcggccgactgctcaacaagctcgccgacgccgtggaggagcacaaagag
gagctcgcggcgctcgaatcgctcgacaacggcaagcccctcaacgacgcgatgggcgcc
gacctaccgctcagcatcgcctgctaccgctactacgcgggctgggccgacaagatcttc
ggccagaccatccccatcaacggcccgttcttcacgtacacgcggcacgaaccgatcggc
gtcgtggggcagatcatcccgtggaacttcccgctcctcatgcaagcgtggaagtgggga
ccggccctcgcgtgcggcaacactctcgtgctgaagcccgccgagcagaccccgctgacc
gcgctccgcgtcgcgcaacttgcacaggaagtcgggttccccgacggcgtgattaacgtc
gtcccggggtacggccccaccgcgggcgcggccctctccggacacatggacgtggacaag
atcgcgttcacgggcgaaaccgggaccggcaagatcgtgatgaccgccgcggcgcagtcc
aacctcaagcgcgtgtcactggagctcggtgggaagtccccaaacatcgtgttcgccgac
gcggacctcgacgccgcggtcgaaggggcgtacttcgggctgttcttcaaccaggggcag
tgctgctgcgccgggagccggctgttcgtgcaggactcggtgtacgatgcgtttgtcgcc
aagatcgtcgagaaggcgaaggggcgcaaggtcggcgacccgttcgcgtcggacaccgag
caggggccgcaagtgagccaggagcagttcgatcgcgtgctcggttacatcgcggcgggg
cagaaggacggcgcgaagatgctcacgggtggcgggcgcgtgggcgagaaggggtacttc
gtgcagccgaccgtgttcggtgacgtgaaggacgacatgaagatcgcacaagaggagatc
ttcgggccggtgatgagcatcttgcgcttcaaggataccgacgaggtaatcgcacgcggg
aaccgcactcagtatggcctcgcggccgcggtgtggacgaaggacgtgaaaaaggccctg
cgcctggcgaacgggctgcgggccgggacggtgtgggtgaactgcttcgacgtgttcgac
gcgggcgcgccgttcggcgggttcaagatgtcgggcatcgggcgcgagttggggcagtac
gcgctccaactctacaccgaagtgaagacggtcacgatggcgatgtga

DBGET integrated database retrieval system