KEGG   Georgenia sp. Z294: FE251_08035
Entry
FE251_08035       CDS       T06026                                 

Definition
(GenBank) dephospho-CoA kinase
  KO
K00859  dephospho-CoA kinase [EC:2.7.1.24]
Organism
gez  Georgenia sp. Z294
Pathway
gez00770  Pantothenate and CoA biosynthesis
gez01100  Metabolic pathways
gez01240  Biosynthesis of cofactors
Module
gez_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:gez00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    FE251_08035
Enzymes [BR:gez01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.24  dephospho-CoA kinase
     FE251_08035
SSDB
Motif
Pfam: CoaE AAA_18 AAA_33 AAA_28 Cytidylate_kin2 PRK AAA_17 SKI ABC_tran
Other DBs
NCBI-ProteinID: QDB79322
UniProt: A0A5B8AS53
LinkDB
Position
complement(1793247..1793837)
AA seq 196 aa
MTRIGLTGGIGAGKSTVARELARLGALVVDADAIAREVVAPGTPGLAAVVAEFGDSVLAP
DGALDRAALGRVVFADPAARARLEAITHPLIGAESARRTAAAPPGTVVVHDVPLIVERGL
AAQYDLVVVVGADEEVRIDRLVRDRGMTREEALARVRAQATDAQRRAVADVWLDNSGTRE
ELLERVRELWRERLAR
NT seq 591 nt   +upstreamnt  +downstreamnt
gtgacacgcatcggtctgaccggcggcatcggggccggcaagtccaccgtcgcccgggag
ctggcccggctcggcgcgctcgtcgtcgacgccgacgccatcgcgcgcgaggtcgtcgcg
ccgggtacgccgggtctcgccgcggtcgtcgcggagttcggggactccgtcctcgcaccg
gacggcgcgctggaccgggcagcgctcggccgggtcgtgttcgccgatcccgcagcccgg
gcgcgcctcgaggcgatcacccacccgctcatcggcgcggagagcgcgcggcgcacggcg
gccgcgcccccgggaaccgtcgtcgtccacgacgtcccgctcatcgtcgaacgcggcctc
gcggcgcagtacgacctcgtcgtcgtcgtcggggcggacgaggaggtccggatcgaccgc
ctcgtcagggaccgcggcatgacccgggaggaggcgctggcgagggtccgggcccaggcc
accgacgcccagcggcgggcggtcgccgacgtctggctcgacaactccggcacccgggag
gagctcctcgagagggtccgcgagctgtggcgggagcggctcgcgcgctga

DBGET integrated database retrieval system