KEGG   Geosporobacter ferrireducens: Gferi_01875Help
Entry
Gferi_01875       CDS       T04493                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
gfe  Geosporobacter ferrireducens
Pathway
gfe02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:gfe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Gferi_01875
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gfe02000]
    Gferi_01875
Enzymes [BR:gfe01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     Gferi_01875
Transporters [BR:gfe02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    Gferi_01875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_22 RsgA_GTPase AAA_29 Rad17 AAA_23 AAA_33 AAA_16 AAA_18 AAA_24 AAA_30 ATP-synt_ab AAA_25 PRK AAA_14 AAA_5 NACHT RNA_helicase NB-ARC AAA_28
Motif
Other DBs
NCBI-ProteinID: AOT68447
UniProt: A0A1D8GC03
LinkDB All DBs
Position
complement(367745..368497)
Genome map
AA seq 250 aa AA seqDB search
MTKIEVNHLNLYYGDFQALIDVNIPIRKNKVTALIGPSGCGKSTFLRTLNRMNDLIDNVR
IEGEILLDGVNIYSEKSDLIQLRKNVGMVFQKPNPFPKTVYENVAYGPKIHGIKDKHKLD
EIVEKSLRGAALWEEVKNRLDKPALGLSGGQQQRLCIARCLAVEPDVLLMDEPTSALDPI
STLKIEDLLEDLKKEYTIVIVTHNMQQAGRVSDYTSFFLNGEIIETDLTDNIFSKPRDKR
TEDYITGRFG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgaagtaaatcatttaaatttatattatggagattttcaggccttaata
gatgttaacattcctattcggaagaataaggttacggcattaatcggaccctctggatgc
ggaaagtcaacttttctacgtacattaaaccgtatgaatgatttgattgataatgtacgt
attgaaggagaaatattattggatggtgtgaatatttatagtgaaaaaagtgatttgatt
cagctgcgaaaaaatgtaggaatggtattccaaaaaccaaatccttttccaaaaacagtt
tacgaaaatgttgcttatggtcccaagattcatggtattaaggataagcacaaattagat
gagattgttgaaaaaagtttgcggggtgcagcattgtgggaagaagtaaaaaatcgcttg
gacaaaccggcgctaggtctttctggtgggcagcagcagcgtttatgtatagccagatgc
ttagctgttgaaccggatgtactcctgatggatgagcctacttctgcattagatcctatt
tcaacactgaaaattgaagacttattagaggatctaaaaaaggaatataccatcgtaatt
gtaactcacaacatgcagcaggcaggtcgcgtatcagattatacatccttctttttaaat
ggtgagatcattgaaacagatcttacagataatattttttcaaagccaagagacaagagg
acagaggattatatcacaggaagattcggctaa

DBGET integrated database retrieval system