KEGG   Geosporobacter ferrireducens: Gferi_21445Help
Entry
Gferi_21445       CDS       T04493                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
gfe  Geosporobacter ferrireducens
Pathway
gfe00010  Glycolysis / Gluconeogenesis
gfe00053  Ascorbate and aldarate metabolism
gfe00071  Fatty acid degradation
gfe00280  Valine, leucine and isoleucine degradation
gfe00310  Lysine degradation
gfe00330  Arginine and proline metabolism
gfe00340  Histidine metabolism
gfe00380  Tryptophan metabolism
gfe00410  beta-Alanine metabolism
gfe00561  Glycerolipid metabolism
gfe00620  Pyruvate metabolism
gfe00625  Chloroalkane and chloroalkene degradation
gfe01100  Metabolic pathways
gfe01110  Biosynthesis of secondary metabolites
gfe01120  Microbial metabolism in diverse environments
gfe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gfe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gferi_21445
   00053 Ascorbate and aldarate metabolism
    Gferi_21445
   00620 Pyruvate metabolism
    Gferi_21445
  Lipid metabolism
   00071 Fatty acid degradation
    Gferi_21445
   00561 Glycerolipid metabolism
    Gferi_21445
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Gferi_21445
   00310 Lysine degradation
    Gferi_21445
   00330 Arginine and proline metabolism
    Gferi_21445
   00340 Histidine metabolism
    Gferi_21445
   00380 Tryptophan metabolism
    Gferi_21445
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Gferi_21445
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Gferi_21445
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Gferi_21445
Enzymes [BR:gfe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Gferi_21445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AOT73249
UniProt: A0A1D8GQS8
LinkDB All DBs
Position
4563726..4565105
Genome map
AA seq 459 aa AA seqDB search
MKESKIMGIVTKQKEFFFSGKSRDLRFRLNSLKKLKDTIIKNEQAIVEALEKDLKKPRLE
SYTSEIGFIISEINYSMKNLNKWARRESVKSPLNLFPSRSYIIKEPYGVALIIGPWNYPF
QLTMVPLIGAIAAGNCCVVKPSELSRESAGVIRKIIYEAFDMPYITVVEGGIEVSECLLE
QNFDKIFFTGSPSVGKIVMEKAARKLIPITLELGGKSPCIVDKKIDIDIAAKRILWGKFF
NAGQTCVAPDYLLVNNEIKEALYDSFKKWLSVFFTEHPENSPDFSRIINKSHFIRLKNYV
KEGKIIIGGQLNESELYIAPTIIEVSDMNSPMMQEEIFGPILPVVSYSGLEEVKRIIRLN
PNPLGFYIFSNDKKIAEQLILNIPFGGGCVNDTLSHLQNQHLPFGGIGNSGIGNYHGKYS
FDAFSHRKSILEKGYAFDLSMKYPPYKNKHVYLKKLLLK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaagcaagattatgggaattgtaacaaaacaaaaggaatttttcttttccggt
aagagcagggacttgaggtttagactgaattcactaaaaaaactaaaagacacaattatc
aagaatgaacaggcaatagtggaagcattggagaaagatttgaaaaagccccgtcttgag
agctatacatctgaaattggattcatcatcagcgaaatcaattattcaatgaagaactta
aataagtgggcaagacgtgaaagcgtcaagtccccgttaaatctttttccatctaggagc
tatattattaaggagccctatggagtagcattgattatcggaccatggaattatcctttt
caactgacaatggtaccattaattggtgccattgctgcagggaactgctgcgttgttaaa
ccttcagagttatcaagagaatcggctggtgttataaggaagataatctatgaagctttt
gatatgccttatattactgtagttgaaggcggcattgaagttagtgaatgccttttagaa
caaaattttgacaaaatattttttacaggaagcccaagtgttgggaaaattgtaatggaa
aaggctgcaagaaaattgattcctatcacgctcgaacttggaggcaaaagtccatgtatc
gtcgataagaagattgatattgatattgctgccaaaagaatactgtggggtaagtttttc
aatgcaggtcaaacctgtgtcgctccggattatttgcttgtaaataatgaaatcaaggag
gccctttacgattcattcaaaaaatggttaagtgttttttttaccgagcatcctgaaaat
agcccagacttttcaaggattattaataaaagccacttcataaggctaaaaaactatgtg
aaagaagggaaaataattataggcggacaattgaatgaaagcgaactttatatagcgcct
acaatcatagaggtatccgatatgaattcgccaatgatgcaggaagagatatttggtccg
atcttgccggttgtctcatattccggtttagaggaggttaaaagaatcattagactcaat
ccgaatcctctgggattctatatattttcaaatgataaaaaaatagctgaacaattgatt
cttaacattccttttggtggtggttgtgtcaatgatacactgagtcatcttcagaatcag
cacctaccgtttggcggcataggcaacagcggaatcgggaattatcacggaaaatacagc
tttgatgcgttttcacacaggaaatcgattttagaaaaaggctatgcttttgatttatcg
atgaaatatccaccttataaaaacaaacatgtgtatttgaaaaaattattattaaaatag

DBGET integrated database retrieval system