KEGG   Geosporobacter ferrireducens: Gferi_26390Help
Entry
Gferi_26390       CDS       T04493                                 

Definition
(GenBank) hypothetical protein
Organism
gfe  Geosporobacter ferrireducens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LytR_cpsA_psr LytR_C
Motif
Other DBs
NCBI-ProteinID: AOT72775
UniProt: A0A1D8GPF5
LinkDB All DBs
Position
5622607..5623839
Genome map
AA seq 410 aa AA seqDB search
MKKFFKVLLISFFCFVIVFSAGAYIFLNSLSAGNDLNTPRETGEDLPEKDEPVNVLILGV
DAKDVKNSQGARSDTIMLATFDPKSKKVNVISIPRDTRVVIRGQKGMDKINHAHAYGGPD
LAIKAVKDLLEVPIHYYVRVDYKALGKIVDDLGGVEVDVPMNMKYSDPTADPPLKIDLKK
GVQVLNGDKAMQFVRFRKGYADQDLGRIKAQQTFMRALADKLLEPQTIIKLPKIAKTFST
YVATDMPVSTITAYALKANGVSMDNIEMLTIPGAPKMVSGVSYYIPDTNKIKTIMTDLFQ
NTLENTQPVNKVEDLSEFKSDVTIEVLNGSGISGVATDVSNKLKAEGYNIVNVDTIKGIK
YSQTHIYDRKNKMAEAKKIAKILDIKDVEKDIYLQAEADITIIVGSDYKK
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagttttttaaggttctactgatatcctttttttgttttgtaatcgtttttagt
gcaggtgcatatatttttctcaatagcctcagtgcaggaaacgacctaaatacccctaga
gaaacaggagaagatttaccggaaaaggacgaacccgttaatgtattaattctaggtgtc
gatgccaaggatgtgaaaaatagtcagggtgcaagatccgatacaattatgttggctacc
tttgatcctaaatccaaaaaagttaatgtgatttctatcccaagggatacgagagtggta
atccgaggacaaaagggaatggataaaattaaccatgcgcatgcttatggtggcccagat
ttagcaataaaagccgttaaggatttacttgaggttccgatccattattatgtacgggtg
gattataaggcattaggaaagattgtagacgatttaggcggcgtggaagtagatgttcct
atgaatatgaaatatagtgatccaacagcagatccacctttaaaaatcgatttaaaaaag
ggtgtacaggttttaaatggggataaagcgatgcagtttgtacgctttagaaaaggatat
gcggatcaagacttgggtagaatcaaagcgcagcaaacctttatgagggctttggcagac
aagctgttggaaccccagaccattattaaactgcctaaaatcgcgaaaactttcagcacc
tatgtagcgacagatatgccagtatccaccataactgcctatgcattaaaagcgaatggg
gtaagtatggataacattgaaatgcttacaattcccggagcacctaaaatggttagcgga
gtatcctattatatccctgacaccaataaaattaaaacaatcatgacggatttattccag
aatactttagaaaatacccagccggtaaacaaagttgaagatctcagtgaatttaaaagt
gatgttaccattgaagtattaaatggctcaggaatcagcggtgtagctacggatgtatcg
aataaattaaaagccgaagggtataatatcgtcaatgtagatacgataaaaggcatcaaa
tacagccaaacccacatctacgacagaaagaataaaatggcagaggctaagaaaatagca
aaaatactagacataaaagatgttgaaaaagatatatatcttcaggcggaggctgacatt
acgattatagtaggcagcgattataaaaaataa

DBGET integrated database retrieval system