KEGG   Gramella flava: GRFL_0692Help
Entry
GRFL_0692         CDS       T04640                                 

Definition
(GenBank) Kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
gfl  Gramella flava
Pathway
gfl00380  Tryptophan metabolism
gfl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gfl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    GRFL_0692
Enzymes [BR:gfl01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     GRFL_0692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 SHMT DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: APU67416
UniProt: A0A1L7I1D3
LinkDB All DBs
Position
complement(832211..833512)
Genome map
AA seq 433 aa AA seqDB search
MKKTPNMQFENSLEFAQKLDREDPMATYRDQFLFPKVNGKDAIYFVGNSLGLQPKIAKDY
VDEIMKDWAELGVEGHFYADKPWWDYHERFSEKLSKVVGASPSEVTVMNTLTVNLHLLMT
SFYRPEGKRFKIVCEEKAFPSDQYMVASQVRFHGYDPSEAIVELKKRDGEQNFRLEDILS
TIREVGEECALVLIGGVNYYTGQVFDMKTITKVGHEVGAMVGWDLAHAAGNIELQLSDWD
VDFAAWCSYKYMNSGPGNASGCFINKRFHGKKDIPRFEGWWGHNKDRRFLMEPEFQPEPT
ANAWQISNAPVLSLAPYLASLQLFDEVGMKKLIAKRNQIVAFLEYVLHDIDRQVDSNFEV
ITPANQEERGTQLSVFLHGEGKELFRYLMDQGVMLDWREPNVIRLAPAPFYCSYEDVFRF
GQILKEGILSKQK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaactccaaatatgcagttcgaaaacagcctggaatttgctcaaaagctggac
cgggaagatcctatggctacctaccgcgaccagttcctttttccgaaggtcaatggaaaa
gatgcgatctattttgtgggaaattcgctgggacttcagccgaaaattgccaaagattac
gtagacgagatcatgaaagactgggccgagctgggtgtggaagggcatttttatgccgat
aaaccctggtgggattaccatgaacgtttttctgaaaaactttcgaaggtggtgggcgct
tctccttccgaagtgaccgtcatgaacaccttgacggtcaacctgcatttattgatgacc
agtttttaccgccccgaaggcaaacgttttaagatcgtttgcgaagaaaaagcatttccc
agcgaccagtatatggtcgcgagccaggtgcgcttccatggttacgacccgtcagaagcc
atcgtggaactgaaaaagcgtgacggagagcaaaatttcaggctcgaagatattttgtca
accatccgagaggtaggagaggagtgtgcgctagtgctgattggtggggtgaattattat
acgggccaggttttcgatatgaagactattacgaaagttggtcacgaagtgggtgcgatg
gttggttgggatctggcacatgctgccggaaacatcgagctgcagttgagtgactgggat
gtagattttgccgcctggtgtagttataagtatatgaattctgggccgggaaatgcttca
ggttgttttatcaataaacgtttccacggaaaaaaggatatcccaagatttgaaggctgg
tggggccataataaagaccgaaggtttttgatggagccggaatttcaacccgaaccaacg
gcgaatgcctggcagatcagtaacgccccggtgctttcactggcgccataccttgcttcc
ctgcagcttttcgatgaggtaggaatgaaaaaactgatagccaaacgcaaccagatcgtg
gcttttttggaatatgtgctgcatgatatcgacaggcaggtagatagcaattttgaagtg
attaccccggcaaaccaggaagaaagaggaacacagctcagcgtttttctgcatggagaa
ggaaaagagctttttcggtatttgatggatcagggagtgatgttggactggcgtgaacca
aatgtgatcaggctggcaccggcaccattttattgttcttatgaagatgttttccggttt
gggcaaattttaaaggaaggaatactttctaaacagaaataa

DBGET integrated database retrieval system