KEGG   Gramella flava: GRFL_0863Help
Entry
GRFL_0863         CDS       T04640                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
gfl  Gramella flava
Pathway
gfl00564  Glycerophospholipid metabolism
gfl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gfl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    GRFL_0863
Enzymes [BR:gfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     GRFL_0863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Thi4 Pyr_redox_3 Pyr_redox_2 HI0933_like NAD_binding_8 Lycopene_cycl FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: APU67587
UniProt: A0A1L7I1U8
LinkDB All DBs
Position
1008615..1010258
Genome map
AA seq 547 aa AA seqDB search
MGNSSSQYLNRESALRKLKENAKWDIIIIGGGATGLGVALDASSRGFKTLLLERGDFANG
TSSRSTKLAHGGVRYLAQGNIALVKEALKERGLMLKNAPHLVHLLPFVIPSYKWWEKFYY
GIGLKIYDWMAQHFRIGKTELINNKKVRSLFDNLNLKGLNGGVIYYDGQFDDARLALNIA
QTSVEHDAVLLNYFEVSDLIKSDGKVVGVIAKDLENNEIFEINANVVINATGVFADSILA
LDHKTAKPIIKVSQGIHLVLRKEFLPSSDALMIPKTSDGRVLFAVPWKDHLLVGTTDTPM
KVPTTQPKALEEEIQFILKTLKSYLVVPPTIDDVLSVFAGLRPLVVPRDTDKGTKEISRD
HKLIIDKTNLITITGGKWTTYRKMAEDTVDEAIQVGNLPEIKCKTEDLKIHGFTETKDIE
DHLDIYGSDATQIRNLVNEDIRFQQKLHPDFPHILAEVIWFIRYEMARTVEDILARRLRI
LFLNAKAAIDLAPEIAEILRKELAKDSKWKDQQLADFKSIAANYLPRTPKLTTALNNKIT
TKLNNHV
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgggaaattctagttcacaatatttaaatcgcgagtctgctttaagaaaacttaaagag
aatgctaagtgggatatcatcattattggtggaggtgctacgggtttaggagtcgcgctt
gacgcgagcagtagaggcttcaaaacactacttttagaaagaggcgattttgctaacggg
acatctagtagaagtacaaagctagcacacggtggggtccgatatcttgctcagggcaat
atagcgttagtcaaagaagctttaaaagaaagaggattaatgctaaagaatgcaccccac
ttagttcatttgctaccttttgtaatccccagttataaatggtgggaaaagttttattat
ggcataggcttgaaaatttatgactggatggctcaacatttccgcataggaaaaacagaa
ctcatcaataataagaaggtgcgaagtctgtttgataaccttaatttaaaaggtttaaat
ggcggggtgatatattatgacgggcaatttgacgatgctcggttagcgttaaatatcgcg
caaacaagtgtcgaacatgacgccgtattactgaactattttgaggtcagtgatcttatc
aaatcagacgggaaagtagttggagtgatcgcaaaagatctggagaataatgaaattttt
gagatcaacgccaatgttgttattaatgctacgggagtttttgctgatagtattttggct
ctggatcacaagacggccaaaccgatcataaaggtaagtcagggaatacatttagtgctg
aggaaagagtttttacccagcagtgatgccttaatgatcccaaaaacatctgacggtcgc
gtattatttgccgtcccctggaaagatcacctactagttggaactactgatacccccatg
aaagttcctacgactcaaccaaaggccttggaagaagaaattcagtttatattaaaaact
ttgaaaagttacctggttgtcccgccaaccattgatgacgttctaagcgtttttgcgggg
ttgcgacctcttgtagtcccaagagatactgataaagggacgaaggaaatatccagagac
cacaaactgatcatcgacaaaacaaacctcattactattaccggaggcaaatggactact
tatcgaaaaatggctgaagataccgtagatgaagccattcaggttggcaatcttcctgaa
ataaaatgtaaaacggaagacctgaaaatccatggatttactgaaacaaaagatatagaa
gatcatttggatatctacggtagtgatgcaacgcaaattcgaaatctagttaatgaggac
ataaggtttcagcaaaaattgcatccggacttccctcatatactagccgaagtcatatgg
ttcatacgttatgaaatggcgcgtacagtagaagatattctggctagaagactgagaatt
ttgtttctaaatgcgaaggcagctattgatttggctcctgaaattgccgaaatcttaaga
aaggaattggctaaggattctaaatggaaggatcaacaactagctgattttaaatcaatc
gcagcgaattacctacctcgaacacctaagttaaccacagctcttaataataaaataact
actaagcttaataatcatgtctaa

DBGET integrated database retrieval system