KEGG   Gramella flava: GRFL_1508Help
Entry
GRFL_1508         CDS       T04640                                 

Definition
(GenBank) Aldehyde dehydrogenase B
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
gfl  Gramella flava
Pathway
gfl00010  Glycolysis / Gluconeogenesis
gfl00053  Ascorbate and aldarate metabolism
gfl00071  Fatty acid degradation
gfl00280  Valine, leucine and isoleucine degradation
gfl00310  Lysine degradation
gfl00330  Arginine and proline metabolism
gfl00340  Histidine metabolism
gfl00380  Tryptophan metabolism
gfl00410  beta-Alanine metabolism
gfl00561  Glycerolipid metabolism
gfl00620  Pyruvate metabolism
gfl00625  Chloroalkane and chloroalkene degradation
gfl01100  Metabolic pathways
gfl01110  Biosynthesis of secondary metabolites
gfl01120  Microbial metabolism in diverse environments
gfl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GRFL_1508
   00053 Ascorbate and aldarate metabolism
    GRFL_1508
   00620 Pyruvate metabolism
    GRFL_1508
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GRFL_1508
   00561 Glycerolipid metabolism
    GRFL_1508
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GRFL_1508
   00310 Lysine degradation
    GRFL_1508
   00330 Arginine and proline metabolism
    GRFL_1508
   00340 Histidine metabolism
    GRFL_1508
   00380 Tryptophan metabolism
    GRFL_1508
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GRFL_1508
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    GRFL_1508
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GRFL_1508
Enzymes [BR:gfl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     GRFL_1508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh MtmB
Motif
Other DBs
NCBI-ProteinID: APU68232
UniProt: A0A1L7I562
LinkDB All DBs
Position
1747842..1749395
Genome map
AA seq 517 aa AA seqDB search
MNKIAEEFGIKQALKDLGLNEINNGTSTGENWFSHGEVLESYSPVDGALIGKVKATTAED
YEKVITTAEEAFKEWRTWPAPKRGEVVRQFNDELRRLKEPLGKLVSYEMGKSYQEGLGEV
QEMIDICDFAVGLSRQLHGLTMHSERPGHRMYEQYHPLGVVGIISAFNFPVAVWSWNTAL
AWVCGDACIWKGSEKTPLTSVACQNIAARVFAENGVPEGISALITGDYRVGEMMTKDERV
PLISATGSIRMGKIVAQAVAARLGKSLLELGGNNAIIVTPDANIKNTVIGAVFGAVGTCG
QRCTSTRRLIVHEEVYDKVKDAIVNAYKQIRIGNPLDENNHVGPLIDKDAVKNYQSALDK
VVEEGGNILVEGGVLEGEGYESGCYVKPAIAEAENHFEIVQHETFAPVLYLLKYSGDVSD
AIAIQNGVKQGLSSAIMTNNLREAERFLSSEGSDCGIANVNIGTSGAEIGGAFGGEKETG
GGRESGSDAWKVYMRRQTNTINYTTELPLAQGIKFDL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaatcgctgaagaatttgggattaaacaagccctgaaagatttaggcttaaac
gaaataaataacgggacttctaccggcgaaaactggttcagccacggggaagtgctcgag
tcatattcaccggttgacggtgctcttatcgggaaggttaaagcaaccactgcggaagat
tacgaaaaagtgatcacgactgcagaagaagcttttaaagaatggagaacctggccggct
cccaaaagaggagaagtagttcgccagttcaacgatgaactccgaaggcttaaggaaccg
cttggaaaactggtatcttatgaaatgggtaaatcgtaccaggaaggtcttggtgaagtt
caggaaatgatcgatatctgtgattttgcagttggtctttccaggcagctgcacggtttg
acgatgcacagcgaacgcccaggacaccgcatgtatgaacaatatcaccctctcggagta
gtgggaattatttccgcattcaactttccggtagccgtatggtcctggaacacggcgctt
gcctgggtttgtggagacgcctgcatctggaaaggatctgaaaaaacaccgctaacttca
gtcgcctgccagaatattgctgccagggtctttgctgaaaatggtgttccggaaggaatt
tcagctttgattaccggggattaccgggtaggtgaaatgatgaccaaagatgaacgcgtc
ccactgatctctgctacgggatccatcagaatgggaaaaattgtcgcacaggcagtagcc
gcaagactgggaaaatcgcttctggaacttggcggaaataacgccattatcgttacgcca
gatgccaatattaagaatacggtgatcggtgcggtatttggagcggttggaacctgcggc
cagcgttgtacttctacgcgaagacttattgttcacgaagaagtctacgataaggtgaag
gatgcgatcgtcaacgcttacaagcagatcaggattgggaacccactggatgaaaacaac
catgtaggaccgctaatcgacaaagatgccgtgaaaaattaccagtcggctctggataag
gtggtggaagaaggcggaaacattctcgtggaaggcggcgtgctggaaggcgaaggttac
gaaagtggctgttatgtgaaaccggcaatcgctgaagcggaaaatcattttgagatcgtt
caacatgaaaccttcgcaccggtgctgtatttactgaaatattccggagatgtgagcgat
gctatcgcgattcagaacggtgtaaaacagggactttcttcagcaattatgactaataat
cttcgggaagccgaaagatttctttcttcggaaggctcagattgcggaattgccaatgtc
aacatcggaacttcaggagccgagatcggcggtgcttttggtggggaaaaggaaaccggc
ggcggccgcgaatcgggttctgacgcctggaaagtctacatgagaagacaaaccaatacg
atcaattataccactgaactgcctctggcacagggaatcaaattcgatctgtaa

DBGET integrated database retrieval system