KEGG   Gramella flava: GRFL_1807Help
Entry
GRFL_1807         CDS       T04640                                 

Definition
(GenBank) ATP-dependent DNA ligase clustered with Ku protein, LigD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
gfl  Gramella flava
Pathway
gfl03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:gfl00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    GRFL_1807
Enzymes [BR:gfl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     GRFL_1807
DNA repair and recombination proteins [BR:gfl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     GRFL_1807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S CTNNBL
Motif
Other DBs
NCBI-ProteinID: APU68531
UniProt: A0A1L7I4L1
LinkDB All DBs
Position
2048752..2049660
Genome map
AA seq 302 aa AA seqDB search
MDQERKFGKRNVKLSNLEKVFFPEAGLTKGDLLDYYEKISEVILPYLKDRPLTMIRFPNG
INDKQFYQKDTPDYFPDWIPTKTIKKKEGGETHYVICNDLATLMYLTNQACITPHIWLSR
KDQADLPDRLIFDLDPSEDDFQKLKLAARKIRKYLKQEFELKSFIMTTGSRGFHISIPIK
RQYDFDEVRSFAQAASKELEAEFPEMFTTASRKAKRDGKIYLDVARNGFGQTAVTPYSVR
PIEGAPVATPLDWDELSKKDLSAQRYTIKNIFRRLGSKDDPWKNMDAEVQDLSAAIKKLQ
KD
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggatcaagaacggaaattcggaaaacgaaatgtaaaattgagtaacctggaaaaggtt
tttttcccggaagcaggtttgaccaaaggcgatctgctggattattatgagaaaatttcc
gaagtcatcctgccctacctgaaagaccggccgcttaccatgattcggtttcccaatggc
atcaatgacaagcagttttatcaaaaggatacgcctgattattttcctgattggatccct
accaaaactatcaaaaaaaaggagggaggggaaactcattatgttatctgtaatgatcta
gccaccctcatgtatctcacaaaccaggcctgcattaccccgcatatctggcttagccga
aaagaccaggcagatcttccagacaggctcatttttgacctcgatccttcagaagacgat
tttcagaaattgaaattggctgcgcgaaaaatcaggaaatatctgaagcaggaattcgaa
ctgaagagttttatcatgaccacgggaagtcgcgggtttcatattagtattcccatcaaa
cgccagtatgattttgatgaggtacgcagtttcgcccaggcagcttccaaagaactggaa
gcggaattccctgaaatgttcactactgcttcccgaaaagcaaaacgggatggaaaaatc
tatctcgacgtggctcggaacggttttgggcaaactgcggtcactccttattccgtcagg
ccgatcgagggagcacctgtcgcgacgcctttagactgggacgaactttccaaaaaagat
ctttccgcgcagcgttataccataaaaaatatcttccgaagactgggaagtaaagatgat
ccctggaaaaatatggatgctgaagttcaggatctttccgcagcgatcaaaaaactgcaa
aaagattag

DBGET integrated database retrieval system