KEGG   Gramella flava: GRFL_3177Help
Entry
GRFL_3177         CDS       T04640                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gfl  Gramella flava
Pathway
gfl00620  Pyruvate metabolism
gfl00680  Methane metabolism
gfl01100  Metabolic pathways
gfl01120  Microbial metabolism in diverse environments
gfl01200  Carbon metabolism
Module
gfl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:gfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GRFL_3177
  09102 Energy metabolism
   00680 Methane metabolism
    GRFL_3177
Enzymes [BR:gfl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     GRFL_3177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 LuxQ-periplasm Kri1 DUF2096
Motif
Other DBs
NCBI-ProteinID: APU69901
UniProt: A0A1L7I8G3
LinkDB All DBs
Position
3514753..3517326
Genome map
AA seq 857 aa AA seqDB search
MNREPRLDRFNDNVLAKYQVYNSIFLTLPYDDIKKTGALLPLFLEICESGFEQNKNPSEI
VERFFQKYGEDPTEEEKVALLFRFIQYIERQVVLFDAIEDASFPIVNNMDGRGTLRSVKE
EAEATQKLDELKKFLKRFKVRPTLTAHPTQFYPGSVLGIITDLDKAIQKNDLTRIKQLLA
QLGKTPFFKKEKPTPLDEAISLIWYFENVFYQSASKIHNYIQQNIFDGEDIGNQVINLGF
WPGGDRDGNPFVTTDITLQVAQRLRKTILLNYYRDVRKLKRRLTFRGVHEMVGEIESALY
EMAVTPKDVIKLKLEDFKSKLHQIKDVLEEKHQSLFIDDVNDLLNKLDLFGYHFATLDIR
QDSRIHQSVLEEVVKTSPSELYPDNFSELSEEEQVKILSTVKGKLDPDSFEEGMAKATIS
SIYAMKEIQKKNGEAGANRYIISNCGSVQGVLQPFAFLRSCDWEEPTVDVIPLFETVPDL
QDAHNVMEQLYTNPEYKAHLERRGNKQTIMLGFSDGTKDGGYLMANWSIYKAKEALTKIS
REYGIKVVFFDGRGGPPARGGGKTHQFYASLGPTIENEEIQITVQGQTISSNFGTRDSCT
YNLEQLVSAGISNEVFNPEKNRLREDDRQTMTDLAEISYETYMDFKKHPRFIPYLEKMST
LKYYAKTNIGSRPSSRNKSAELNLSDLRAIPFVGSWSQLKQNVPGFFGVGTAMEALDKKG
EFDRVKQLYENSDFFKTLLENSMMSLTKSFFPLTAYMKNDPEFGEFWELIHEEFERTKKM
LLKVTGYNTLMQNQPAGRASIQARERIVLPLLTIQQHALRMVQQLSKENVDDERLETYEK
MVTRSLYGNINASRNSA
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgaacagagaaccgagactcgaccgattcaatgataatgttctggcaaaatatcaggta
tacaacagtatcttcctgactttgccgtacgacgacatcaagaagacgggggcgctgctt
cctctttttcttgaaatttgcgaatctggttttgagcaaaacaagaacccttcagaaatt
gttgaacgtttttttcagaaatatggtgaagatcctacggaagaagaaaaggtagccttg
ctattccgcttcattcagtatattgaaagacaagttgtactttttgatgctattgaagat
gcttctttccccatcgtaaataatatggacggccgcggaactttacgaagtgtcaaggaa
gaagctgaagctacccagaaactggatgagttgaagaaattcctgaaacgttttaaagtg
aggccaacccttacagcccacccaactcagttctatcctggttctgttcttggtattatt
actgacctggataaggccattcagaaaaatgacctgaccagaatcaaacaattactggct
cagttagggaaaacaccatttttcaagaaagagaaacctactccgttagacgaggcgatc
agcctgatctggtattttgaaaatgtgttctaccagagtgccagtaaaatccataattac
attcagcagaatatctttgacggagaagatatcggcaaccaggttatcaatttaggcttc
tggcctggaggtgaccgcgatggaaatccgtttgttacaacagatataaccttgcaggta
gctcagcgattgaggaagaccattttgctaaattattacagagacgttcgtaaactgaag
cgaagactaaccttcagaggcgtgcatgaaatggtgggagagatcgaaagtgcactctac
gaaatggcagtaacacctaaggatgttattaaactgaagcttgaagattttaaatctaag
ttgcatcaaatcaaagatgtattagaagaaaaacatcagtcattatttattgatgacgta
aatgatttactgaacaagctcgatcttttcggttatcattttgccactttggatattcgc
caggattcacgaattcaccaaagcgttttagaagaagtggtaaaaacaagcccttcagaa
ttatatccggataatttttcggaattgagtgaagaagagcaggtaaagattctgagcacc
gttaaaggtaaactggatcctgattcttttgaagaaggtatggctaaagctaccatttca
tctatttacgccatgaaggagattcagaagaaaaacggtgaagccggagccaatcgatat
atcatcagtaactgcggaagcgtacagggtgtcctgcaaccatttgcatttcttagatct
tgtgactgggaagaacctacagtagatgtgattccgttattcgaaacagtcccagatctt
caggacgcgcataatgtgatggagcaactctataccaatccggaatacaaagcacacctg
gaacgccgcggaaacaaacaaaccattatgctaggtttcagcgatggtactaaagacggg
ggttacctgatggccaactggagtatttacaaagccaaagaagctttaactaaaatttcc
agagaatacggtatcaaggtcgtcttttttgacggtcgtggaggaccaccggcgcgtgga
ggaggaaaaactcaccagttctatgcttctcttggacctactattgaaaatgaggaaatc
cagatcacggtacaagggcaaaccattagttccaacttcggaacccgggattcctgtacc
tataacctggaacaactggtaagtgccggtatttccaatgaagttttcaatccggaaaag
aatcgtttgcgagaggatgatcgtcaaacaatgaccgatcttgcagagatttcctatgaa
acatatatggacttcaaaaaacacccacgattcattccatatcttgagaaaatgagtacg
ctgaagtattatgccaaaaccaacattggtagcaggccttcttcaaggaataaatcagcg
gaactgaatttaagcgatctgcgtgctattccgtttgttggaagctggagtcagctaaaa
cagaacgttccgggattcttcggagtgggaacagcaatggaagcgctggataaaaaaggc
gaattcgatcgtgtaaaacagttgtatgagaattcagattttttcaaaacgctactggaa
aatagcatgatgagtcttaccaagtcattctttcctttgacagcgtatatgaaaaatgat
cctgaatttggagagttctgggagctgattcatgaagaatttgagcgtactaaaaagatg
ttactgaaagtgactggttacaatactttgatgcagaaccagcctgccggaagagcttcg
atccaggcgcgtgaaagaattgtgttaccattactaaccattcagcagcacgctttaaga
atggtgcagcaattaagtaaagaaaatgtagatgacgagcgtttggaaacatatgagaaa
atggtaacccgttctctctatggaaatatcaacgccagtcgtaattcagcataa

DBGET integrated database retrieval system