KEGG   Gramella flava: GRFL_3376
Entry
GRFL_3376         CDS       T04640                                 

Definition
(GenBank) Cobalt-zinc-cadmium resistance protein CzcA
Organism
gfl  Gramella flava
SSDB
Motif
Pfam: ACR_tran MMPL DUF2207 SecD_SecF ABC_membrane
Other DBs
NCBI-ProteinID: APU70100
UniProt: A0A1L7I947
LinkDB
Position
complement(3732681..3735785)
AA seq 1034 aa
MLNKILSISLQNRLLVLLAAVVLSITGFYLARNMNVDVFPDLTAPTVTILTEAHGMESEE
VEKLVTYQLETAMNGSPNVRRIRSSSAAGISIVWVEFDWGTDIYKARQIVSERIPMVREN
LPSGIGAPTMAPISSIMGEVMLLGVTSDSLSPMELRTLSDWQIRPRIKAIGGIANVVVIG
GDYKQYQVFANPGKMKYYDVSLEELTEKVREANTNAPGGFLNEYGNQYIIKGNGRAYALE
DLEEAVVKQVNGQSIKIKDIAEVQIGSADKIGDGSLNAEPAVILTISKQPDVNTLELTER
LDEAIAELETSLPESVEIKSQIFRQADFIDASISNLNMTLLEGAFFVVIVLFIFLMNWRT
TLISLLAIPISLLVSIIVLKMLGYTINTMSLGGMAIAIGALVDDAIIDVENVYKRLRENI
RKPKAERQGVITVVREASVEIRSSIIIATLIIIVSFVPLFFLGGMEGRLLKPLGIAFITS
VLTSLVVAVTVTPVLCTYLLKKEKMLKKQAEGTKVERWLQKSYADILNRALRIPKTVITV
TVIAFLLSIALFTQLGRSFLPEFNEGSMVISVVGPPGMSLEESNKTGKQVEQLLLEMPEV
AVVTRRTGRAELDEHAQGVNAAEIDVPFTLEDKSKEEFFEDVRNKLSIVPGVNITLGQPI
AHRIDHMLSGTRANIAIKIFGPDLQQLYEIGKSVEENIKPIDGLADVAVDQQIEVPQIKI
TPKRQILSAYGMTVGQLMVQVDVAFAGHEVGEIYEGQKYFDLVVRYEEGFRNSIEKIKTA
LIGLPNGSQVPLEQLAQVSSVSSPNTISREDVQRKIVVAANVQGRDLRSAVEEIRETVNS
SVTIPEGYRVQYGGQFESESRASQMLLITAVIAIFVIFLLLYFEFNNVKLAFVVLINLPL
ALIGGILIVYFTSGIVSIASTIGFISLFGIATRNGILLVSRYEDLRKEGWKGYELIKTGA
LDRLNPILMTAFTTGLALIPLALKGGEPGSEIQSPMAVVILGGLLSATILNLVVIPCVYE
LVTHNNAGNQNIIE
NT seq 3105 nt   +upstreamnt  +downstreamnt
atgttaaataaaatattatcaatttcgcttcagaacaggcttttggttcttctggcagcg
gttgtactgagtattaccgggttttacctcgcacgtaatatgaacgtagatgtattccct
gatcttactgcacctactgtgaccatacttacggaagcccacggtatggagtcggaagaa
gtagagaaactagtgacctaccagcttgagaccgcgatgaatggctcgccaaatgtgaga
aggattcgttcttcttctgcggcaggaatttctatcgtttgggttgaattcgactggggc
accgatatttataaagccagacagatcgtaagtgagcgtattccaatggttcgtgaaaac
ctgcccagtgggatcggtgctcccacaatggcacctatttcttccattatgggagaagta
atgttgctgggagtcacttcagacagtcttagccctatggagttaagaacattatcagac
tggcagatccgtccgcgtattaaagctatcggagggattgccaacgtagtggtgattgga
ggtgattataagcaataccaggtttttgctaatcccggaaaaatgaaatattacgacgta
agccttgaagagcttactgagaaagtccgggaagcgaatactaacgccccgggtggtttc
ctgaatgaatatggaaatcagtatatcattaaaggaaatggaagagcctatgctttagaa
gatttggaagaagctgtggtcaagcaggtaaatggccagagcatcaagatcaaagatata
gctgaagtgcaaattggatctgccgataaaattggtgatggttccctgaatgcagaaccg
gcggttatcctcactatatccaagcaacccgatgtgaatacactggagcttacagaaagg
cttgatgaagccatcgccgaactggagaccagtcttcctgaaagcgtagagatcaaaagc
cagatcttccgacaagccgattttattgatgcttccataagtaatcttaatatgacgctg
ctggaaggagcattttttgtagtgattgtactctttattttcttaatgaactggcgtaca
accctcatttcgctgctggcaattccaatttcattactggtgtcaataattgttttgaaa
atgcttgggtataccatcaatacaatgagtttaggaggtatggctattgcaattggagct
ttggtagatgatgccatcattgatgttgagaacgtttacaaacgccttcgggagaacatt
cgaaaaccaaaagctgaaaggcagggggttattacagtggtaagggaagcttcggttgaa
attagaagttcgatcatcattgcgacacttatcattattgtttcttttgtaccgctattt
tttcttggcggaatggaagggcgattgctgaagcctctcggaatagcatttataacttca
gtcctgacttctttggtggtggcggtaaccgtcactcctgtattgtgcacctatcttctg
aaaaaggaaaagatgctgaagaaacaggctgaagggactaaagttgaaagatggttacag
aagtcttatgctgatattctaaatagagcattaaggattcccaaaacagtgataacggtc
acagtgatcgcttttttactgagtattgccctctttactcaattaggaagaagttttctt
ccggaatttaatgagggttctatggtaattagtgtggttggtcctccgggaatgtcgctg
gaagaaagcaataagaccgggaaacaggtagagcaattgttgcttgagatgccggaagtt
gctgtggttaccagaagaacaggaagagccgaattggacgagcatgcccagggggtgaat
gccgccgagatcgatgtcccgtttaccctggaagataagtccaaggaggaattttttgaa
gatgttagaaataaactcagcatcgttcctggtgttaatatcacccttggacagcctatt
gcccaccgtatagatcatatgctctcaggaaccagggccaatatcgcgatcaaaattttt
ggccctgatctgcaacagttgtatgaaataggtaaaagcgtggaggagaatataaaacct
atcgatggacttgccgatgtagctgtagatcagcagatcgaagtaccgcaaatcaagatc
actccaaaacgtcagatcctttccgcttacggaatgacagttggccagctgatggtgcag
gtggatgtggcttttgcaggacacgaagtaggggagatctatgaaggacagaagtatttt
gatctggtggtacgttatgaagaaggtttcagaaatagcattgagaaaatcaaaaccgct
ttgattggtctgccgaatggatcacaggtgccactagagcagctggcacaagtttcttcg
gttagcagccctaataccataagcagggaagatgtgcagcgtaaaattgtcgttgccgct
aatgtgcagggccgtgacttgagaagtgcggtagaagagatccgggaaactgtaaattct
tcggtgactattccggaaggttatagggtacagtatggcgggcagttcgaaagtgagtca
agagcttcgcaaatgcttttaatcacggccgtgatagccatttttgtgatctttttattg
ctttattttgaattcaataatgtaaagctggcatttgttgtacttatcaatttgccattg
gcacttattggcggaatcctgatcgtttactttacttccggaattgtaagtatagcttct
actattggatttataagtctctttggaatagcaacccgaaatggaatcttactcgtttcg
agatatgaagatctaagaaaagaaggttggaaaggttatgaacttataaaaaccggggcg
ttagatagactgaatccaatcctgatgaccgcttttacaactggtttggcgcttattccg
ctagccttaaaaggaggtgaaccgggtagtgagatccaaagccctatggcggttgttatt
ttgggtggtttactttctgcaaccattctgaatctggtggttataccttgtgtgtatgaa
ctagtaacccataacaatgcaggtaatcaaaatataattgaatag

DBGET integrated database retrieval system