KEGG   Gramella forsetii: GFO_0300Help
Entry
GFO_0300          CDS       T00448                                 

Definition
(GenBank) ATP-dependent DNA ligase family protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
gfo  Gramella forsetii
Pathway
gfo03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    GFO_0300
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gfo03400]
    GFO_0300
Enzymes [BR:gfo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     GFO_0300
DNA repair and recombination proteins [BR:gfo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     GFO_0300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme GH3
Motif
Other DBs
NCBI-ProteinID: CAL65286
UniProt: A0LY41
LinkDB All DBs
Position
348976..351384
Genome map
AA seq 802 aa AA seqDB search
MSLGDYIRKRDFRNTPEPEAKISKANKQRFVVQRHQASRLHYDLRLEIDGVLKSWAVPKG
PSMNPRDKRLAIHTEDHPIKYLEFHGTIPKGNYGAGEMKIWDSGIFESASSMDLLEQLSS
GNLKIRFSGKKLKGEFALVRTNRGEERNQWLLIKKSDNYSTDLNYDAEDLIERSDPKPGK
LIELNFKDPVKPMLATSTKEIFNDPDWIYELKWDGYRLIAHVNDGKVNLHSRNGISYNSK
FPELVKDLKTISHEAILDGEVVVVDEDGLPSFEKLQNYDTKTEGALKFYVFDMLYLNGHS
TLNLKLLERKSFIPEILEETQLAIFCDHIEGMGTAFYQKAISTGMEGVIAKKADSTYSPG
YRTEQWLKVKAEESLETLICGYTDSEGALFGSLILGIIKDGTLSYIGNCGTGFSNKTQAE
LLRKMEEREIDTNPFEKKPNLKGRKANWVRPELVCEVTFSEWTKAGRMRHPVFKGLREDK
SSGDLNNKSLPKEPKQERKSSSNSLEIDGKEVKFTNLDKIYWPESGLRKYDLIDYYLQVS
EYILPYLRDRPQNLHRHPNGIHKKGFYQKDNEGLIEDWVETTRIYSKSTNRDIEYLLCQD
EATLLYMANLGCIEINPWNSRIDHLDRPDYTVIDLDPSDKNSFDEVIEVALIAREILASA
KINAYLKTSGSSGLHIYLPINAEYSYDEARDFTKLLCYFIQEKTSGLTSMDRAVKNRKDK
IYLDYLQNRRGQTLASAYCVRPKEGAPVSAPLEWEELKKGLKITDFNIKNMLARLKEKGD
LFQAVLHDKVDMEKALERLNKL
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttggggattacatcaggaaaagagattttagaaatactccagaaccagaggct
aaaatttccaaagcgaacaagcagcgttttgtagtacagcggcatcaggcaagtagattg
cattatgatctacgtttggagatagatggagtcttaaagagctgggcggttcccaagggt
ccttcgatgaatccaagagataagaggctagctatacatacagaagatcaccctataaaa
tatttagaattccacggaactattccaaaaggtaattatggtgccggtgagatgaagatc
tgggattctggtatttttgagtctgccagttcaatggatcttttagaacaactttcgtct
ggaaatttaaaaattagattttccggtaaaaaactgaaaggagaatttgctctggttaga
acaaatcgcggggaggaaagaaatcaatggctgcttataaaaaaatcagataattactcc
acagatcttaattatgatgctgaagacctaatcgagagatcagatccaaagccgggcaaa
ctgatagaactcaattttaaagatccggtgaagcccatgctcgcaacgagcaccaaagaa
atatttaatgatccagactggatctacgaattaaaatgggatggctacaggcttatcgca
catgtcaatgatggcaaggtgaatcttcattccagaaatggaatatcttacaattctaag
tttccggaattagtaaaagatctgaaaacaatctcacatgaagcaatactggatggtgaa
gtagtggtggtagatgaagacggtctgccgagctttgaaaaattacagaactatgatact
aaaactgagggcgctttaaaattttatgtttttgatatgctttatctaaatgggcatagc
accttgaatttaaaattgctggaacgtaaaagttttattccggagattctggaagaaact
caattagctattttttgtgaccatatcgaaggcatgggaactgcattctatcaaaaagct
atcagcaccggaatggagggtgtgatagcgaaaaaagcagattcaacctattctccggga
tacaggaccgagcagtggttaaaagtaaaggcggaagaaagtcttgaaacccttatatgt
ggatatacagattctgaaggagctctttttggatcattaattcttggaattataaaggat
ggaacactttcttatataggaaattgcggaacaggtttttcgaataagactcaggcggaa
ttgctgagaaaaatggaagagcgagagatagatactaatccttttgaaaaaaaaccaaac
ttaaaaggtagaaaagcaaactgggtgagaccagaattagtttgtgaagttactttttct
gaatggacaaaagcgggaagaatgcgtcacccggtatttaaaggtttaagggaagataaa
tcatctggagatcttaataataaatcgttgccaaaggaaccaaagcaggaaagaaaatct
tcttcaaatagcttagagatagacggaaaagaggttaaatttactaatcttgataaaatt
tactggcctgaatccggacttcgaaaatatgatctaattgattactatcttcaggtttca
gaatatattctaccatatttaagagatcgacctcaaaatttacacaggcatcctaacgga
atccataaaaaaggattttatcagaaagacaatgaaggtttgatcgaggattgggttgag
accaccagaatttattctaaatctacaaacagagatatagaatatcttctttgtcaggac
gaggccaccttattatatatggcaaatctgggctgtattgagattaatccctggaattca
agaatagaccatttagatagaccagattatacagtaatagatctggatccttcagataag
aacagtttcgacgaggtgatcgaagttgcattgatcgccagggaaatacttgcttcagct
aaaattaatgcttatttaaaaacttcaggttctagtggcctgcatatatacctgcctatt
aatgctgaatattcttatgatgaagcgagagattttacaaaattgctctgttattttatt
caggagaaaacatcgggtctaactagtatggatcgggctgtgaaaaacagaaaggataag
atctatctagattatctgcaaaatcgtcggggtcaaacccttgcttcggcttattgcgta
agaccaaaagagggtgctccggtatcagcaccattggaatgggaagaactgaaaaaaggt
ctgaaaattaccgatttcaatattaaaaatatgcttgcaaggttgaaagaaaagggagat
ctatttcaggccgtgttgcatgacaaagtagatatggaaaaagctttggagcgccttaat
aaattataa

DBGET integrated database retrieval system